6FVU: 26S proteasome, s2 state
26S proteasome, s2 state. Determined by electron microscopy at 4.5 Å resolution. Released 22 Aug 2018.
- Method
- Electron microscopy
- Resolution
- 4.5 Å
- Organism
- Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
- Chains
- 47
- Atoms
- 110,592
- Mol. weight
- 1583.27 kDa
- Ligands
- ADP, MG, ATP
- Released
- 22 Aug 2018
Explore 6FVU in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6FVU contains 581 α-helices and 522 β-strands across 47 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain 1: 6 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 11-17 | 7 | 116 |
| β-strand | 20-26 | 7 | 116 |
| β-strand | 29-31 | 3 | 76 |
| β-strand | 34-37 | 4 | 76 |
| β-strand | 43-45 | 3 | 117 |
| β-strand | 50-55 | 6 | 117 |
| α-helix | 58-79 | 22 | |
| α-helix | 81-83 | 3 | |
| α-helix | 84-96 | 13 | |
| β-strand | 105-111 | 7 | 117 |
| β-strand | 117-122 | 6 | 117 |
| β-strand | 129-131 | 3 | 117 |
| β-strand | 133-137 | 5 | 116 |
| α-helix | 144-149 | 6 | |
| α-helix | 157-174 | 18 | |
| β-strand | 175 | 1 | 74 |
| β-strand | 182-187 | 6 | 116 |
| β-strand | 192-197 | 6 | 116 |
| α-helix | 199-204 | 6 | |
Chain 2: 6 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 31-36 | 6 | 85 |
| β-strand | 40-46 | 7 | 85 |
| β-strand | 49-51 | 3 | 71 |
| β-strand | 54-57 | 4 | 71 |
| β-strand | 63-65 | 3 | 118 |
| β-strand | 70-76 | 7 | 118 |
| α-helix | 78-99 | 22 | |
| α-helix | 102-104 | 3 | |
| α-helix | 105-118 | 14 | |
| β-strand | 125-133 | 9 | 118 |
| β-strand | 136-142 | 7 | 118 |
| β-strand | 148-149 | 2 | 118 |
| β-strand | 153-157 | 5 | 85 |
| α-helix | 160-170 | 11 | |
| α-helix | 177-192 | 16 | |
| β-strand | 202-208 | 7 | 85 |
| β-strand | 213-220 | 8 | 85 |
| α-helix | 225-228 | 4 | |
| β-strand | 241-246 | 6 | 119 |
Chain 3: 7 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-8 | 4 | |
| β-strand | 11-16 | 6 | 119 |
| β-strand | 20-25 | 6 | 119 |
| β-strand | 29 | 1 | 120 |
| β-strand | 37 | 1 | 120 |
| β-strand | 43-46 | 4 | 121 |
| β-strand | 49-55 | 7 | 121 |
| α-helix | 57-78 | 22 | |
| α-helix | 81-83 | 3 | |
| α-helix | 84-96 | 13 | |
| β-strand | 105-112 | 8 | 121 |
| β-strand | 119-125 | 7 | 121 |
| β-strand | 128-131 | 4 | 121 |
| β-strand | 136-140 | 5 | 119 |
| α-helix | 143-153 | 11 | |
| α-helix | 160-175 | 16 | |
| β-strand | 178 | 1 | 65 |
| β-strand | 186-191 | 6 | 119 |
| β-strand | 195-200 | 6 | 119 |
| α-helix | 201 | 1 | |
Chain 4: 5 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-9 | 6 | 122 |
| β-strand | 12-18 | 7 | 122 |
| β-strand | 21-23 | 3 | 123 |
| β-strand | 26-29 | 4 | 123 |
| β-strand | 35-39 | 5 | 124 |
| β-strand | 42-48 | 7 | 124 |
| α-helix | 52-70 | 19 | |
| α-helix | 74-76 | 3 | |
| α-helix | 77-93 | 17 | |
| β-strand | 100-108 | 9 | 124 |
| β-strand | 113-119 | 7 | 124 |
| β-strand | 125-127 | 3 | 124 |
| β-strand | 130-132 | 3 | 122 |
| α-helix | 138-147 | 10 | |
| α-helix | 154-171 | 18 | |
| β-strand | 174 | 1 | 61 |
| β-strand | 179-184 | 6 | 122 |
| β-strand | 189-192 | 4 | 122 |
Chain 5: 6 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 77-82 | 6 | 125 |
| β-strand | 87-91 | 5 | 125 |
| β-strand | 95 | 1 | 126 |
| β-strand | 100 | 1 | 56 |
| β-strand | 103 | 1 | 126 |
| β-strand | 109-113 | 5 | 127 |
| β-strand | 116-119 | 4 | 127 |
| β-strand | 121 | 1 | 128 |
| α-helix | 124-145 | 22 | |
| α-helix | 148-150 | 3 | |
| α-helix | 151-164 | 14 | |
| β-strand | 173 | 1 | 128 |
| β-strand | 174-180 | 7 | 127 |
| β-strand | 184-190 | 7 | 127 |
| β-strand | 196-199 | 4 | 127 |
| β-strand | 201-205 | 5 | 125 |
| α-helix | 208-217 | 10 | |
| α-helix | 225-242 | 18 | |
| β-strand | 243 | 1 | 54 |
| β-strand | 249-255 | 7 | 125 |
| β-strand | 260-267 | 8 | 125 |
| α-helix | 268-279 | 12 | |
Chain 6: 6 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 19-24 | 6 | 3 |
| β-strand | 29-34 | 6 | 3 |
| β-strand | 37-39 | 3 | 4 |
| β-strand | 42-45 | 4 | 4 |
| β-strand | 52-53 | 2 | 5 |
| β-strand | 58-64 | 7 | 5 |
| α-helix | 66-85 | 20 | |
| α-helix | 90-93 | 4 | |
| α-helix | 94-107 | 14 | |
| β-strand | 115-122 | 8 | 5 |
| β-strand | 128-133 | 6 | 5 |
| β-strand | 139-141 | 3 | 5 |
| β-strand | 144-148 | 5 | 3 |
| α-helix | 151-158 | 8 | |
| β-strand | 168 | 1 | 6 |
| β-strand | 177 | 1 | 6 |
| α-helix | 178-182 | 5 | |
| α-helix | 185-201 | 17 | |
| β-strand | 203 | 1 | 44 |
| β-strand | 209-215 | 7 | 3 |
| β-strand | 220-226 | 7 | 3 |
Chain 7: 7 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 40-41 | 2 | 11 |
| β-strand | 44-48 | 5 | 12 |
| β-strand | 52-58 | 7 | 12 |
| β-strand | 60-63 | 4 | 11 |
| β-strand | 66-70 | 5 | 11 |
| β-strand | 75-77 | 3 | 11 |
| β-strand | 82-89 | 8 | 11 |
| α-helix | 90-107 | 18 | |
| α-helix | 122-139 | 18 | |
| β-strand | 145-152 | 8 | 11 |
| β-strand | 158-164 | 7 | 11 |
| β-strand | 170-171 | 2 | 11 |
| β-strand | 174-176 | 3 | 12 |
| α-helix | 178-181 | 4 | |
| α-helix | 184-191 | 8 | |
| α-helix | 198-200 | 3 | |
| α-helix | 203-220 | 18 | |
| β-strand | 221 | 1 | 36 |
| β-strand | 228-234 | 7 | 12 |
| β-strand | 238-245 | 8 | 12 |
| α-helix | 255-257 | 3 | |
Chain a: 9 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 26-31 | 6 | |
| α-helix | 32-34 | 3 | |
| β-strand | 42-46 | 5 | 1 |
| β-strand | 51-56 | 6 | 1 |
| β-strand | 72-74 | 3 | 2 |
| β-strand | 80-84 | 5 | 2 |
| α-helix | 87-108 | 22 | |
| α-helix | 111-113 | 3 | |
| α-helix | 114-127 | 14 | |
| α-helix | 135-137 | 3 | |
| β-strand | 140-146 | 7 | 2 |
| β-strand | 152-157 | 6 | 2 |
| β-strand | 163-166 | 4 | 2 |
| β-strand | 169-171 | 3 | 1 |
| α-helix | 175-189 | 15 | |
| α-helix | 199-214 | 16 | |
| β-strand | 223-229 | 7 | 1 |
| β-strand | 232-235 | 4 | 1 |
| α-helix | 238-249 | 12 | |
39 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Proteasome subunit alpha type-1 | A, a | protein | 242 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P21243 (AlphaFold model) |
| Proteasome subunit alpha type-2 | B, b | protein | 249 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P23639 (AlphaFold model) |
| Proteasome subunit alpha type-3 | C, c | protein | 244 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P23638 (AlphaFold model) |
| Proteasome subunit alpha type-4 | D, d | protein | 251 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P40303 (AlphaFold model) |
| Proteasome subunit alpha type-5 | E, e | protein | 249 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P32379 |
| Proteasome subunit alpha type-6 | F, f | protein | 231 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P40302 |
| Probable proteasome subunit alpha type-7 | G, g | protein | 242 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P21242 |
| Proteasome subunit beta type-1 | 1, h | protein | 196 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P38624 |
| Proteasome subunit beta type-2 | 2, i | protein | 226 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P25043 |
| Proteasome subunit beta type-3 | 3, j | protein | 204 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P25451 |
| Proteasome subunit beta type-4 | 4, k | protein | 195 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P22141 |
| Proteasome subunit beta type-5 | 5, l | protein | 212 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P30656 |
21 more molecules are not listed.
Sequence of entity 1 (A, a), FASTA
>6FVU_1 Proteasome subunit alpha type-1 (chains A, a)
AGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTV
SYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYT
QRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKS
KIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAENIEERLVAIA
EQ
Sequence of entity 2 (B, b), FASTA
>6FVU_2 Proteasome subunit alpha type-2 (chains B, b)
TDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETL
SKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEA
TQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWND
ELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTSQ
EINDRLEAL
Sequence of entity 3 (C, c), FASTA
>6FVU_3 Proteasome subunit alpha type-3 (chains C, c)
GSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDT
STEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQG
YTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK
DDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILVK
TGIT
Sequence of entity 4 (D, d), FASTA
>6FVU_4 Proteasome subunit alpha type-4 (chains D, d)
YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK
VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS
GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE
PPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEKQEQ
QEQDKKKKSNH
Sequence of entity 5 (E, e), FASTA
>6FVU_5 Proteasome subunit alpha type-5 (chains E, e)
FLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLES
DSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLAL
RFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQA
ELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELIK
ELKEKEAAE
Sequence of entity 6 (F, f), FASTA
>6FVU_6 Proteasome subunit alpha type-6 (chains F, f)
NNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQKKI
IKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNTQSY
GGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFIKID
GNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI
Sequence of entity 7 (G, g), FASTA
>6FVU_7 Probable proteasome subunit alpha type-7 (chains G, g)
GYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNVK
IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY
NSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPEG
LSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAIDFAQKE
IN
Sequence of entity 8 (1, h), FASTA
>6FVU_8 Proteasome subunit beta type-1 (chains 1, h)
TSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQ
YHLELYTSQYGTPSTETAASVFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVH
KLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSGGVIRMVVLTA
AGVERLIFYPDEYEQL
Sequence of entity 9 (2, i), FASTA
>6FVU_9 Proteasome subunit beta type-2 (chains 2, i)
TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIG
SNIELHSLYTSREPRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTD
VGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVDVCVMEI
GKDAEYLRNYLTPNVREEKQKSYKFPRGTTAVLKESIVNICDIQEE
Sequence of entity 10 (3, j), FASTA
>6FVU_10 Proteasome subunit beta type-3 (chains 3, j)
SDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDVT
TLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPFI
AGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPEDLFETISQALLNAADRDALS
GWGAVVYIIKKDEVVKRYLKMRQD
Sequence of entity 11 (4, k), FASTA
>6FVU_11 Proteasome subunit beta type-4 (chains 4, k)
MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYI
QANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQID
YLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVI
VKIVDKDGIRQVDDF
Sequence of entity 12 (5, l), FASTA
>6FVU_12 Proteasome subunit beta type-5 (chains 5, l)
TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWETWLG
SQCRLHELREKERISVAAASKILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGT
RLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSGGSVNLYHV
TEDGWIYHGNHDVGELFWKVKEEEGSFNNVIG
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 1 |
| MG | Magnesium ion | Mg | 6 |
| ATP | Adenosine-5'-triphosphate | C10 H16 N5 O13 P3 | 5 |
Primary citation
Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating. Eisele, M.R., Reed, R.G., Rudack, T. et al. Cell Rep (2018) 24:1301-1315.e5. DOI 10.1016/j.celrep.2018.07.004 · PubMed
Other PDB entries of the same protein (UniProt P21243 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 1RYP 1.9 Å, Crystal structure of the 20S proteasome from yeast at 2.4 Å resolution
- 8RVQ 2.02 Å, 20S proteasome from pre1-1
- 4R17 2.1 Å, Ligand-induced aziridine-formation at subunit beta5 of the yeast 20S proteasome
- 8RVL 2.14 Å, Proteasomal late precursor complex from pre1-1
- 8U7U 2.16 Å, Proteasome 20S Core Particle from Beta 3 D205 deletion
- 1G65 2.25 Å, Crystal structure of epoxomicin:20s proteasome reveals a molecular basis for selectivity…
- 8RVP 2.28 Å, Proteasomal late precursor complex from pre1-1, state 2
- 4QVP 2.3 Å, yCP beta5-M45T mutant in complex with bortezomib
- 5CZ4 2.3 Å, Yeast 20S proteasome at 2.3 A resolution
- 6HWE 2.3 Å, Yeast 20S proteasome beta2-G45A mutant in complex with carfilzomib
- 9GBK 2.39 Å, Blm10-20S proteasome complex from pre1-1
- 1G0U 2.4 Å, A gated channel into the proteasome core particle
Browse structure collections
About this viewer
MolViewer shows 6FVU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.