Crystal structure of the p97 D2 domain in a helical split-washer conformation. Determined by X-ray diffraction at 2.15 Å resolution. Released 10 Apr 2019.
Explore 6G2Y in 3D Show helices and sheets RCSB PDB PDBe
6G2Y contains 18 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 470 | 1 | 1 |
| α-helix | 476-478 | 3 | |
| α-helix | 483-498 | 16 | |
| α-helix | 500-505 | 6 | |
| α-helix | 509-511 | 3 | |
| β-strand | 513-517 | 5 | 1 |
| α-helix | 524-534 | 11 | |
| β-strand | 538-543 | 6 | 1 |
| α-helix | 544-547 | 4 | |
| α-helix | 558-568 | 11 | |
| β-strand | 572-577 | 6 | 1 |
| α-helix | 597-609 | 13 | |
| α-helix | 613-615 | 3 | |
| β-strand | 617-623 | 7 | 1 |
| α-helix | 626-628 | 3 | |
| α-helix | 631-634 | 4 | |
| β-strand | 642-644 | 3 | 1 |
| α-helix | 646-648 | 3 | |
| α-helix | 650-660 | 11 | |
| β-strand | 666 | 1 | 2 |
| α-helix | 672-677 | 6 | |
| α-helix | 684-709 | 26 | |
| β-strand | 731 | 1 | 2 |
| α-helix | 733-739 | 7 | |
| α-helix | 740-742 | 3 | |
| α-helix | 749-761 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transitional endoplasmic reticulum ATPase | A | protein | 303 | Homo sapiens | P55072 (AlphaFold model) |
>6G2Y_1 Transitional endoplasmic reticulum ATPase (chains A) SALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPG CGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDS IAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQ LIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRE SIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQT LQQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 1 |
| ELQ | [3,4-bis(fluoranyl)phenyl]-(4-methylpiperazin-1-yl)methanone | C12 H14 F2 N2 O | 1 |
Water and common crystallization additives (MPD, DMS, NA) are not listed.
Crystal structure of the catalytic D2 domain of the AAA+ ATPase p97 reveals a putative helical split-washer-type mechanism for substrate unfolding. Stach, L., Morgan, R.M., Makhlouf, L. et al. FEBS Lett (2020) 594:933-943. DOI 10.1002/1873-3468.13667 · PubMed
Other PDB entries of the same protein (UniProt P55072 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6G2Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.