X-ray structure of NSD3-PWWP1. Determined by X-ray diffraction at 2.53 Å resolution. Released 26 Jun 2019.
Explore 6G3T in 3D Show helices and sheets RCSB PDB PDBe
6G3T contains 24 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 273-276 | 4 | 1 |
| β-strand | 284-288 | 5 | 1 |
| β-strand | 298-300 | 3 | 1 |
| β-strand | 306-312 | 7 | 1 |
| β-strand | 319-323 | 5 | 1 |
| α-helix | 324-326 | 3 | |
| β-strand | 327-329 | 3 | 1 |
| α-helix | 333-335 | 3 | |
| α-helix | 336-342 | 7 | |
| α-helix | 362-378 | 17 | |
| α-helix | 383-390 | 8 | |
| α-helix | 391-393 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 273-276 | 4 | 3 |
| β-strand | 284-288 | 5 | 3 |
| β-strand | 298-300 | 3 | 3 |
| β-strand | 306-312 | 7 | 3 |
| β-strand | 319-323 | 5 | 3 |
| α-helix | 324-326 | 3 | |
| β-strand | 327-329 | 3 | 3 |
| α-helix | 333-335 | 3 | |
| α-helix | 336-342 | 7 | |
| α-helix | 362-378 | 17 | |
| α-helix | 383-390 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 273-276 | 4 | 4 |
| β-strand | 284-288 | 5 | 4 |
| β-strand | 298-300 | 3 | 4 |
| β-strand | 306-312 | 7 | 4 |
| α-helix | 313 | 1 | |
| β-strand | 319-323 | 5 | 4 |
| α-helix | 324-326 | 3 | |
| β-strand | 327-329 | 3 | 4 |
| α-helix | 333-335 | 3 | |
| α-helix | 336-342 | 7 | |
| α-helix | 362-378 | 17 | |
| α-helix | 383-390 | 8 | |
| α-helix | 391-393 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone-lysine N-methyltransferase NSD3 | A, B, C, D | protein | 153 | Homo sapiens | Q9BZ95 (AlphaFold model) |
>6G3T_1 Histone-lysine N-methyltransferase NSD3 (chains A, B, C, D) GEAPVQPILSSVPTTEVSTGVKFQVGDLVWSKVGTYPWWPCMVSSDPQLEVHTKINTRGA REYHVQFFSNQPERAWVHEKRVREYKGHKQYEELLAEATKQASNHSEKQKIRKPRPQRER AQWDIGIAHAEKALKMTREERIEQYTFIYIDKQ
Fragment-based discovery of a chemical probe for the PWWP1 domain of NSD3. Bottcher, J., Dilworth, D., Reiser, U. et al. Nat Chem Biol (2019) 15:822-829. DOI 10.1038/s41589-019-0310-x · PubMed
Other PDB entries of the same protein (UniProt Q9BZ95 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6G3T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.