Crystal Structures of the Single PDZ Domains from GRASP65 and their Interaction with the Golgin GM130. Determined by X-ray diffraction at 2.12 Å resolution. Released 24 Apr 2019.
Explore 6G8W in 3D Show helices and sheets RCSB PDB PDBe
6G8W contains 5 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 113-118 | 6 | 1 |
| α-helix | 123-126 | 4 | |
| α-helix | 129-130 | 2 | |
| β-strand | 134-139 | 6 | 1 |
| α-helix | 149-155 | 7 | |
| β-strand | 161-167 | 7 | 1 |
| β-strand | 172-178 | 7 | 1 |
| β-strand | 192-196 | 5 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 113-118 | 6 | 2 |
| α-helix | 123-127 | 5 | |
| β-strand | 134-138 | 5 | 2 |
| α-helix | 149-155 | 7 | |
| β-strand | 161-167 | 7 | 2 |
| β-strand | 172-178 | 7 | 2 |
| β-strand | 192-196 | 5 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Golgi reassembly-stacking protein 1 | A, B | protein | 97 | Homo sapiens | Q9BQQ3 (AlphaFold model) |
>6G8W_1 Golgi reassembly-stacking protein 1 (chains A, B) ASEQVWHVLDVEPSSPAALAGLRPYTDYVVGSDQILQESEDFFTLIESHEGKPLKLMVYN SKSDSCREVTVTPNAAWGGEGSLGCGIGYGYLHRIPT
Crystal Structures of the Single PDZ Domains from GRASP65 and their Interaction with the Golgin GM130. Jurk, C.M., Roske, Y., Heinemann, U. Croat Chem Acta (2018). DOI 10.5562/cca3341
Other PDB entries of the same protein (UniProt Q9BQQ3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6G8W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.