6GBO: Oligomerization domain of Vp35 from Ebola virus
Crystal Structure of the oligomerization domain of Vp35 from Ebola virus. Determined by X-ray diffraction at 2.1 Å resolution. Released 10 Oct 2018.
- Method
- X-ray diffraction
- Resolution
- 2.1 Å
- Organism
- Ebola virus
- Chains
- 12
- Atoms
- 6,842
- Mol. weight
- 99.23 kDa
- Released
- 10 Oct 2018
Explore 6GBO in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6GBO contains 34 α-helices and 0 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A, E, G and K: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 83-118 | 36 | |
| α-helix | 119-123 | 5 | |
| α-helix | 124-140 | 17 | |
| α-helix | 143-151 | 9 | |
Chains B, F, H and L: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 83-152 | 70 | |
Chain C: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 83-116 | 34 | |
| α-helix | 119-126 | 8 | |
| α-helix | 128-146 | 19 | |
Chain D: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 83-116 | 34 | |
| α-helix | 119-125 | 7 | |
| α-helix | 128-142 | 15 | |
| α-helix | 143-148 | 6 | |
Chain I: 3 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 83-116 | 34 | |
| α-helix | 119-126 | 8 | |
| α-helix | 128-145 | 18 | |
Chain J: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 83-85 | 3 | |
| α-helix | 86-116 | 31 | |
| α-helix | 119-125 | 7 | |
| α-helix | 128-147 | 20 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Polymerase cofactor VP35 | A, B, C, D, E, F, G, H, I, J, K, L | protein | 73 | Ebola virus | Q05127 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L), FASTA
>6GBO_1 Polymerase cofactor VP35 (chains A, B, C, D, E, F, G, H, I, J, K, L)
MSFEEVVQTLASLATVVQQQTIASESLEQRITSLENGLKPVYDMAKTISSLNRVCAEMVA
KYDLLLEHHHHHH
Primary citation
Structures of Ebola and Reston Virus VP35 Oligomerization Domains and Comparative Biophysical Characterization in All Ebolavirus Species. Zinzula, L., Nagy, I., Orsini, M. et al. Structure (2019) 27:39-54.e6. DOI 10.1016/j.str.2018.09.009 · PubMed
Other PDB entries of the same protein (UniProt Q05127 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3FKE 1.4 Å, Structure of the Ebola VP35 Interferon Inhibitory Domain
- 4IBG 1.41 Å, Ebola virus VP35 bound to small molecule
- 4IBI 1.47 Å, Ebola virus VP35 bound to small molecule
- 4IBJ 1.54 Å, Ebola virus VP35 bound to small molecule
- 3L29 1.7 Å, Crystal Structure of Zaire Ebola VP35 interferon inhibitory domain K319A/R322A mutant
- 4IBC 1.75 Å, Ebola virus VP35 bound to small molecule
- 4IBB 1.75 Å, Ebola virus VP35 bound to small molecule
- 4IBD 1.84 Å, Ebola virus VP35 bound to small molecule
- 4IBK 1.85 Å, Ebola virus VP35 bound to small molecule
- 4IJE 1.9 Å, Crystal structure of the Zaire ebolavirus VP35 interferon inhibitory domain…
- 3L27 1.95 Å, Crystal structure of Zaire Ebola VP35 interferon inhibitory domain R312A mutant
- 4IBE 1.95 Å, Ebola virus VP35 bound to small molecule
Browse structure collections
About this viewer
MolViewer shows 6GBO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.