6GGH: Human jak1 kinase domain

Human jak1 kinase domain in complex with inhibitor. Determined by X-ray diffraction at 1.7 Å resolution. Released 22 May 2019.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,118
Mol. weight: 68.36 kDa
Ligands: EYQ
Released: 22 May 2019

Explore 6GGH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GGH contains 36 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	869	1	1
α-helix	872-874	3
β-strand	875-883	9	1
β-strand	887-894	8	1
β-strand	903-910	8	1
α-helix	917-930	14
β-strand	937	1	2
α-helix	938-939	2
β-strand	940-944	5	1
β-strand	953-957	5	1
β-strand	963	1	2
α-helix	964-967	4
α-helix	977-996	20
β-strand	999-1000	2	3
α-helix	1006-1008	3
β-strand	1009-1013	5	2
β-strand	1016-1019	4	2
β-strand	1026-1027	2	3
α-helix	1028-1029	2
β-strand	1035-1036	2	4
α-helix	1045-1047	3
α-helix	1050-1055	6
β-strand	1057-1058	2	4
α-helix	1060-1075	16
α-helix	1080-1082	3
α-helix	1084-1092	9
α-helix	1100-1110	11
α-helix	1114-1117	4
α-helix	1122-1131	10
α-helix	1136-1138	3
α-helix	1140-1141	2
α-helix	1142-1153	12

Chain B: 18 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	869	1	5
α-helix	872-874	3
β-strand	875-883	9	5
β-strand	888-894	7	5
β-strand	903-909	7	5
α-helix	917-930	14
β-strand	937	1	6
α-helix	938-939	2
β-strand	940-944	5	5
β-strand	953-957	5	5
β-strand	963	1	6
α-helix	964-971	8
α-helix	977-996	20
β-strand	999-1000	2	7
α-helix	1006-1008	3
β-strand	1009-1013	5	6
β-strand	1016-1019	4	6
β-strand	1026-1027	2	7
α-helix	1028-1029	2
β-strand	1034-1036	3	8
α-helix	1045-1047	3
α-helix	1050-1055	6
β-strand	1057-1059	3	8
α-helix	1060-1075	16
α-helix	1080-1082	3
α-helix	1084-1092	9
α-helix	1097-1099	3
α-helix	1100-1109	10
α-helix	1114-1117	4
α-helix	1122-1130	9
α-helix	1136-1138	3
α-helix	1142-1153	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein kinase JAK1	A, B	protein	292	Homo sapiens	P23458 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6GGH_1 Tyrosine-protein kinase JAK1 (chains A, B)
TEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADL
KKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLK
YAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRD
SPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVT
RLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLK

Ligands and cofactors

ID	Name	Formula	Copies
EYQ	~{N}-[5-methyl-4-[7-[[(2~{R})-2-(4-methylpiperazin-1-yl)propanoyl]amino]-1~{H}-…	C25 H31 N7 O2	2

Primary citation

Inhibition of local lung inflammation by a potent and selective JAK1 inhibitor; activation of JAK1, but not JAK3, is critical to IL-4R mediated immune cell signalling. Nilsson, M. To be published.

Other PDB entries of the same protein (UniProt P23458 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6N7A 1.33 Å, Structure of the human JAK1 kinase domain with compound 39
10PI 1.54 Å, JAK1 kinase (JH1 domain) in complex with povorcitinib
6N77 1.64 Å, Structure of the human JAK1 kinase domain with compound 15
6N7C 1.69 Å, Structure of the human JAK1 kinase domain with compound 56
6RSH 1.71 Å, Structure based optimization of JAK1-ATP binding pocket Inhibitors in the aminopyrazole…
8S85 1.75 Å, Crystal structure of JAK1 JH1 domain in complex with an inhibitor
6RSD 1.76 Å, Structure based optimization of JAK1-ATP binding pocket Inhibitors in the aminopyrazole…
6N7D 1.78 Å, Structure of the human JAK1 kinase domain with compound 54
4GS0 1.8 Å, Crystal structure of SHP1 catalytic domain with JAK1 activation loop peptide
4L00 1.8 Å, Crystal structure of the apo Jak1 pseudokinase domain
6ELR 1.8 Å, Human jak1 kinase domain in complex with compound 7
6RSB 1.8 Å, Structure based optimization of JAK1-ATP binding pocket Inhibitors in the aminopyrazole…

Browse structure collections

About this viewer

MolViewer shows 6GGH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.