6GPS: CCR2A

Crystal structure of CCR2A in complex with mk-0812. Determined by X-ray diffraction at 3.3 Å resolution. Released 2 Jan 2019.

Method: X-ray diffraction
Resolution: 3.3 Å
Organisms: Homo sapiens, Clostridium pasteurianum
Chains: 1
Atoms: 2,683
Mol. weight: 48.81 kDa
Ligands: ZN, F7N
Released: 2 Jan 2019

Explore 6GPS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GPS contains 17 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	38-65	28
α-helix	66-70	5
α-helix	76-92	17
α-helix	95-101	7
α-helix	110-142	33
α-helix	153-178	26
β-strand	179-184	6	1
β-strand	187-192	6	1
α-helix	196-207	12
α-helix	208-212	5
α-helix	213-1001	20
β-strand	1004-1006	3	2
β-strand	1012-1013	2	2
β-strand	1019	1	3
α-helix	1020-1022	3
β-strand	1024	1	3
α-helix	1046-1048	3
β-strand	1049-1051	3	2
α-helix	237-240	4
α-helix	242-267	26
α-helix	280-296	17
α-helix	297-299	3
α-helix	301-307	7
α-helix	311-318	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-C chemokine receptor type 2,Rubredoxin,C-C chemokine receptor type 2	A	protein	429	Homo sapiens, Clostridium pasteurianum	P00268 (AlphaFold model), P41597 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6GPS_1 C-C chemokine receptor type 2,Rubredoxin,C-C chemokine receptor type 2 (chains A)
LSTSRSRFIRNTQESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNM
LVVLILINYKKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYH
IGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVVTSVITWLVAVFASVPNIIFTKC
QKEDSVYVCGPYFPRGWNNFHTIMRNILGLVLPLLIMVICYSGILKTLLRMKKYTCTVCG
YIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEEEKKRHRDVRVIFTIMI
VYFLFWTPYNIVILLNTFQEFFGLSNCESTSQLDQATQVTETLGMTHCCINPIIYAFVGE
EFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGLLDGRGKGKSIGRAPEASLQD
KEGAEVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1
F7N	[(3~{S},4~{S})-3-methoxyoxan-4-yl]-[(1~{R},3~{S})-3-propan-2-yl-3-[[3-(trifluor…	C24 H35 F3 N3 O3	1

Primary citation

Crystal Structure of CC Chemokine Receptor 2A in Complex with an Orthosteric Antagonist Provides Insights for the Design of Selective Antagonists. Apel, A.K., Cheng, R.K.Y., Tautermann, C.S. et al. Structure (2019) 27:427-438.e5. DOI 10.1016/j.str.2018.10.027 · PubMed

Other PDB entries of the same protein (UniProt P00268 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2PVE 0.79 Å, NMR and X-ray Analysis of Structural Additivity in Metal Binding Site-Swapped Hybrids of…
1IRO 1.1 Å, Rubredoxin (oxidized, fe(iii)) at 1.1 Å resolution
1IRN 1.2 Å, Rubredoxin (ZN-substituted) at 1.2 Å resolution
4RXN 1.2 Å, Crystallographic refinement of rubredoxin at 1.2 Å resolution
5RXN 1.2 Å, Combined crystallographic refinement and energy minimization of rubredoxin at 1.2 Å…
1SMM 1.36 Å, Crystal Structure of Cp Rd L41A mutant in oxidized state
1SMW 1.38 Å, Crystal Structure of Cp Rd L41A mutant in reduced state 2 (soaked)
1SMU 1.43 Å, Crystal Structure of Cp Rd L41A mutant in reduced state 1 (drop-reduced)
1B13 1.5 Å, Clostridium pasteurianum rubredoxin G10A mutant
1FHH 1.5 Å, X-ray crystal structure of oxidized rubredoxin
1FHM 1.5 Å, X-ray crystal structure of reduced rubredoxin
1R0I 1.5 Å, cadmium-substituted rubredoxin

Browse structure collections

About this viewer

MolViewer shows 6GPS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.