6GPX: CCR2A

Crystal structure of CCR2A in complex with mk-0812. Determined by X-ray diffraction at 2.7 Å resolution. Released 2 Jan 2019.

Method: X-ray diffraction
Resolution: 2.7 Å
Organisms: Homo sapiens, Clostridium pasteurianum
Chains: 2
Atoms: 5,035
Mol. weight: 84.27 kDa
Ligands: F7N, OLA, ZN
Released: 2 Jan 2019

Explore 6GPX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GPX contains 34 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	37-69	33
α-helix	76-92	17
α-helix	95-103	9
α-helix	109-143	35
α-helix	154-178	25
β-strand	179-184	6	1
β-strand	187-192	6	1
α-helix	196-207	12
α-helix	208-212	5
α-helix	213-229	17
β-strand	230-232	3	2
α-helix	233-234	2
β-strand	235-237	3	3
β-strand	243-244	2	3
β-strand	250	1	4
α-helix	251-253	3
β-strand	255	1	4
α-helix	261-263	3
β-strand	269	1	5
β-strand	276	1	5
α-helix	277-279	3
β-strand	280-282	3	3
α-helix	283	1
α-helix	292-318	27
α-helix	320-323	4
α-helix	328-346	19
α-helix	347-350	4
α-helix	352-359	8
α-helix	361-372	12

Chain B: 15 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	36-69	34
α-helix	76-92	17
α-helix	95-103	9
α-helix	109-139	31
α-helix	140-144	5
β-strand	146-148	3	2
α-helix	150-152	3
α-helix	153-178	26
β-strand	179-184	6	6
β-strand	187-192	6	6
α-helix	196-207	12
α-helix	208-212	5
α-helix	213-228	16
α-helix	242-267	26
α-helix	269-272	4
α-helix	277-295	19
α-helix	296-299	4
α-helix	301-307	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-C chemokine receptor type 2,Rubredoxin,C-C chemokine receptor type 2	A, B	protein	349	Homo sapiens, Clostridium pasteurianum	P00268 (AlphaFold model), P41597 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6GPX_1 C-C chemokine receptor type 2,Rubredoxin,C-C chemokine receptor type 2 (chains A, B)
GAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINYKKLKCLTDIYLLNLAISD
LLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFA
LKARTVTFGVVTSVITWLVAVFASVPNIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNI
LGLVLPLLIMVICYSGILKTLLRMKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDW
VCPLCGVGKDQFEEVEEEKKRHRDVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNC
ESTSQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGEVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
F7N	[(3~{S},4~{S})-3-methoxyoxan-4-yl]-[(1~{R},3~{S})-3-propan-2-yl-3-[[3-(trifluor…	C24 H35 F3 N3 O3	2
OLA	Oleic acid	C18 H34 O2	14
ZN	Zinc ion	Zn	1

Primary citation

Crystal Structure of CC Chemokine Receptor 2A in Complex with an Orthosteric Antagonist Provides Insights for the Design of Selective Antagonists. Apel, A.K., Cheng, R.K.Y., Tautermann, C.S. et al. Structure (2019) 27:427-438.e5. DOI 10.1016/j.str.2018.10.027 · PubMed

Other PDB entries of the same protein (UniProt P00268 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2PVE 0.79 Å, NMR and X-ray Analysis of Structural Additivity in Metal Binding Site-Swapped Hybrids of…
1IRO 1.1 Å, Rubredoxin (oxidized, fe(iii)) at 1.1 Å resolution
1IRN 1.2 Å, Rubredoxin (ZN-substituted) at 1.2 Å resolution
4RXN 1.2 Å, Crystallographic refinement of rubredoxin at 1.2 Å resolution
5RXN 1.2 Å, Combined crystallographic refinement and energy minimization of rubredoxin at 1.2 Å…
1SMM 1.36 Å, Crystal Structure of Cp Rd L41A mutant in oxidized state
1SMW 1.38 Å, Crystal Structure of Cp Rd L41A mutant in reduced state 2 (soaked)
1SMU 1.43 Å, Crystal Structure of Cp Rd L41A mutant in reduced state 1 (drop-reduced)
1B13 1.5 Å, Clostridium pasteurianum rubredoxin G10A mutant
1FHH 1.5 Å, X-ray crystal structure of oxidized rubredoxin
1FHM 1.5 Å, X-ray crystal structure of reduced rubredoxin
1R0I 1.5 Å, cadmium-substituted rubredoxin

Browse structure collections

About this viewer

MolViewer shows 6GPX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.