6GSR: Ferritin heavy chain

Single Particle Cryo-EM map of human Transferrin receptor 1 - H-Ferritin complex at 5.5 Angstrom resolution. Determined by electron microscopy at 5.5 Å resolution. Released 27 Mar 2019.

Method: Electron microscopy
Resolution: 5.5 Å
Organism: Homo sapiens
Chains: 26
Atoms: 45,308
Mol. weight: 650.6 kDa
Released: 27 Mar 2019

Explore 6GSR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GSR contains 250 α-helices and 76 β-strands across 26 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains Aa, Ac, Ad, Ae, Af, Ag, Ah, Ai, Aj, Ak, Al, Am, An, Ao, Ap, Ar, As, At, Au, Av, Aw, Ax, Ay and Az: 8 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	14-40	27
α-helix	49-76	28
β-strand	85	1	1
α-helix	86-88	3
α-helix	96-123	28
α-helix	127-133	7
α-helix	134-138	5
α-helix	139-158	20
α-helix	164-173	10

Chains Ab and Aq: 29 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	124-136	13
α-helix	140-146	7
α-helix	160-176	17
β-strand	180-192	13	2
α-helix	197-198	2
β-strand	199-204	6	3
β-strand	209-214	6	3
β-strand	220-221	2	4
β-strand	226-230	5	3
β-strand	232-234	3	5
α-helix	240-244	5
β-strand	254-258	5	5
β-strand	260	1	6
β-strand	262	1	6
α-helix	264-272	9
β-strand	278-282	5	5
β-strand	299-300	2	4
β-strand	334-336	3	5
α-helix	339-346	8
β-strand	349-352	4	5
α-helix	353-354	2
α-helix	355-357	3
β-strand	364-367	4	5
β-strand	371-377	7	3
β-strand	380-393	14	2
β-strand	398-408	11	2
α-helix	416-420	5
α-helix	421-438	18
β-strand	446-453	8	2
α-helix	456-458	3
α-helix	461-469	9
α-helix	474-476	3
β-strand	478-483	6	2
β-strand	488	1	2
β-strand	493-498	6	2
α-helix	500-502	3
α-helix	503-510	8
β-strand	514	1	7
β-strand	521	1	7
α-helix	528-531	4
α-helix	532-535	4
α-helix	541-542	2
α-helix	543-548	6
β-strand	552-558	7	2
α-helix	573-579	7
α-helix	583-603	21
α-helix	613-625	13
α-helix	626-628	3
α-helix	640-662	23
α-helix	668-681	14
α-helix	682-685	4
β-strand	686	1	8
β-strand	699	1	8
α-helix	709-717	9
α-helix	728-749	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ferritin heavy chain	Aa, Ac, Ad, Ae, Af, Ag, Ah, Ai, Aj, Ak, Al, Am, An, Ao, Ap, Ar, As, At, Au, Av, Aw, Ax, Ay, Az	protein	182	Homo sapiens	P02794 (AlphaFold model)
Transferrin receptor protein 1	Ab, Aq	protein	640	Homo sapiens	P02786 (AlphaFold model)

Sequence of entity 1 (Aa, Ac, Ad, Ae, Af, Ag, Ah, Ai, Aj, Ak, Al, Am, An, Ao, Ap, Ar, As, At, Au, Av, Aw, Ax, Ay, Az), FASTA

>6GSR_1 Ferritin heavy chain (chains Aa, Ac, Ad, Ae, Af, Ag, Ah, Ai, Aj, Ak, Al, Am, An, Ao, Ap, Ar, As, At, Au, Av, Aw, Ax, Ay, Az)
TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSH
EEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKL
ATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDN
ES

Sequence of entity 2 (Ab, Aq), FASTA

>6GSR_2 Transferrin receptor protein 1 (chains Ab, Aq)
RLYWDDLKRKLSEKLDSTDFTSTIKLLNENSYVPREAGSQKDENLALYVENQFREFKLSK
VWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTK
KDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVLIYMDQTKFPIVNAELSFFGH
AHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNMEGDCPSDWKTD
STCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSG
VGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFT
YINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNA
AFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIK
LTHDVELNLDYERYNSQLLSFVRDLNQYRADIKEMGLSLQWLYSARGDFFRATSRLTTDF
GNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGSHTLPALLENLKLRK
QNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF

Primary citation

Cryo-EM structure of the human ferritin-transferrin receptor 1 complex. Montemiglio, L.C., Testi, C., Ceci, P. et al. Nat Commun (2019) 10:1121-1121. DOI 10.1038/s41467-019-09098-w · PubMed

Other PDB entries of the same protein (UniProt P02794 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6B8F 1.06 Å, Contracted Human Heavy-Chain Ferritin Crystal-Hydrogel Hybrid
6B8G 1.13 Å, Twice-Contracted Human Heavy-Chain Ferritin Crystal-Hydrogel Hybrid
7A6A 1.15 Å, 1.15 A structure of human apoferritin obtained from Titan Mono- BCOR microscope
8B7O 1.17 Å, X-ray structure of Auranofin-human H-chain ferritin
6WYF 1.25 Å, Crystal structure of Human H-chain Ferritin variant 157C Delta C-star Modified with a…
6Z6U 1.25 Å, 1.25 A structure of human apoferritin obtained from Titan Mono-BCOR microscope
7RRP 1.27 Å, Apoferritin structure at 1.27 angstrom resolution determined from a 300 kV Titan Krios…
7A6B 1.33 Å, 1.33 A structure of human apoferritin obtained from Titan Mono- BCOR microscope
4Y08 1.34 Å, One minute iron loaded human H ferritin
7K3V 1.34 Å, Apoferritin structure at 1.34 angstrom resolution determined from a 300 kV Titan Krios…
7K3W 1.36 Å, Apoferritin structure at 1.36 angstrom resolution determined from a 300 kV Titan Krios…
9RGH 1.38 Å, X-ray structure of a polyoxidovanadate/human H-ferritin adduct obtained when the protein…

Browse structure collections

About this viewer

MolViewer shows 6GSR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.