Crystal structure of the kelch domain of human KLHL20 in complex with DAPK1 peptide. Determined by X-ray diffraction at 1.09 Å resolution. Released 8 Aug 2018.
Explore 6GY5 in 3D Show helices and sheets RCSB PDB PDBe
6GY5 contains 5 α-helices and 40 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 318-323 | 6 | 1 |
| β-strand | 326-327 | 2 | 2 |
| β-strand | 330-331 | 2 | 2 |
| β-strand | 335-339 | 5 | 1 |
| β-strand | 344-348 | 5 | 1 |
| α-helix | 349-351 | 3 | |
| β-strand | 356 | 1 | 3 |
| β-strand | 359-363 | 5 | 4 |
| β-strand | 366-370 | 5 | 4 |
| β-strand | 373 | 1 | 3 |
| β-strand | 378 | 1 | 3 |
| β-strand | 382-386 | 5 | 4 |
| β-strand | 391-393 | 3 | 4 |
| α-helix | 397-399 | 3 | |
| β-strand | 404 | 1 | 5 |
| β-strand | 407-411 | 5 | 6 |
| β-strand | 414-418 | 5 | 6 |
| β-strand | 421 | 1 | 5 |
| β-strand | 426 | 1 | 5 |
| β-strand | 430-434 | 5 | 6 |
| β-strand | 439-442 | 4 | 6 |
| α-helix | 444-446 | 3 | |
| β-strand | 451 | 1 | 7 |
| β-strand | 454-458 | 5 | 8 |
| β-strand | 461-465 | 5 | 8 |
| β-strand | 468 | 1 | 7 |
| β-strand | 473 | 1 | 7 |
| β-strand | 477-481 | 5 | 8 |
| β-strand | 486-489 | 4 | 8 |
| α-helix | 491-493 | 3 | |
| β-strand | 498 | 1 | 9 |
| β-strand | 501-505 | 5 | 10 |
| β-strand | 508-512 | 5 | 10 |
| β-strand | 515 | 1 | 9 |
| β-strand | 520 | 1 | 9 |
| β-strand | 524-528 | 5 | 10 |
| β-strand | 533-537 | 5 | 10 |
| α-helix | 538-540 | 3 | |
| β-strand | 545 | 1 | 11 |
| β-strand | 548-552 | 5 | 11 |
| β-strand | 555-562 | 8 | 11 |
| β-strand | 567-575 | 9 | 11 |
| β-strand | 580-584 | 5 | 11 |
| β-strand | 592 | 1 | 2 |
| β-strand | 595-600 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Kelch-like protein 20 | A | protein | 304 | Homo sapiens | Q9Y2M5 (AlphaFold model) |
| Death-associated protein kinase 1 | U | protein | 11 | Homo sapiens | P53355 (AlphaFold model) |
>6GY5_1 Kelch-like protein 20 (chains A) SMQGPRTRPRKPIRCGEVLFAVGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVGVS VLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGFLYAVGGQ DGVSCLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYN PQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPRTNQWSPVVAMT SRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVFDPDANTWRLYGGMNYRRLGGGVGVIKM THCE
>6GY5_2 Death-associated protein kinase 1 (chains U) LGLPDLVAKYN
Structural Basis for Recruitment of DAPK1 to the KLHL20 E3 Ligase. Chen, Z., Picaud, S., Filippakopoulos, P. et al. Structure (2019) 27:1395-1404.e4. DOI 10.1016/j.str.2019.06.005 · PubMed
Other PDB entries of the same protein (UniProt Q9Y2M5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6GY5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.