6H03: Open conformation of the membrane attack complex

Open conformation of the membrane attack complex. Determined by electron microscopy at 5.6 Å resolution. Released 19 Dec 2018.

Method: Electron microscopy
Resolution: 5.6 Å
Organism: Homo sapiens
Chains: 24
Atoms: 102,310
Mol. weight: 1631.06 kDa
Ligands: NAG
Released: 19 Dec 2018

Explore 6H03 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6H03 contains 345 α-helices and 588 β-strands across 24 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 92 β-strands

Element	Residues	Length	Sheet
β-strand	24-28	5	1
β-strand	31-32	2	2
β-strand	37-42	6	1
β-strand	52-57	6	3
β-strand	67-71	5	3
β-strand	80-85	6	1
α-helix	92	1
β-strand	103-108	6	3
β-strand	114-116	3	3
β-strand	119-120	2	2
β-strand	125-130	6	4
β-strand	134-135	2	5
β-strand	140-141	2	6
β-strand	143-148	6	4
β-strand	159-164	6	7
β-strand	170-176	7	7
β-strand	182-184	3	4
α-helix	186-187	2
β-strand	188-189	2	6
β-strand	197-198	2	5
β-strand	200-204	5	7
β-strand	213-215	3	7
β-strand	218-219	2	5
β-strand	228-233	6	8
α-helix	241-244	4
β-strand	246-253	8	8
α-helix	258	1
β-strand	259	1	8
α-helix	260	1
β-strand	262-271	10	9
β-strand	287-293	7	9
β-strand	296	1	9
β-strand	297-301	5	8
α-helix	303-309	7
β-strand	323-330	8	9
β-strand	337-342	6	9
β-strand	353-356	4	10
β-strand	362-363	2	11
β-strand	369-376	8	10
β-strand	382	1	10
β-strand	387-396	10	11
β-strand	402-403	2	11
α-helix	404-406	3
β-strand	407-410	4	11
β-strand	417-422	6	10
β-strand	428-437	10	11
β-strand	449-456	8	11
β-strand	467	1	12
β-strand	476	1	13
β-strand	482-486	5	12
β-strand	498-505	8	14
β-strand	508-516	9	14
β-strand	524-528	5	12
α-helix	532-534	3
β-strand	538-544	7	14
β-strand	555-561	7	14
β-strand	563	1	13
β-strand	572-575	4	15
β-strand	582	1	16
β-strand	587-593	7	15
β-strand	598-606	9	17
α-helix	613-615	3
α-helix	627-630	4
α-helix	642-649	8
β-strand	651-654	4	1
β-strand	773-780	8	17
β-strand	783-789	7	15
α-helix	796	1
β-strand	797-804	8	17
β-strand	809-811	3	17
α-helix	812-813	2
β-strand	815-817	3	17
β-strand	819	1	16
β-strand	823-827	5	18
β-strand	833-834	2	19
β-strand	839	1	20
β-strand	842-847	6	18
β-strand	853-861	9	21
β-strand	865-866	2	22
β-strand	886-888	3	21
β-strand	892-897	6	18
β-strand	900	1	20
β-strand	901-902	2	22
β-strand	908-916	9	21
β-strand	921-927	7	21
β-strand	929-930	2	19
β-strand	935-937	3	23
β-strand	941-944	4	23
β-strand	945	1	24
β-strand	954	1	24
β-strand	957-959	3	25
β-strand	967	1	26
α-helix	968	1
β-strand	974-979	6	23
α-helix	995-998	4
α-helix	1011-1028	18
α-helix	1038-1058	21
β-strand	1060	1	27
β-strand	1066	1	27
α-helix	1076-1090	15
α-helix	1098-1110	13
β-strand	1112	1	28
β-strand	1118	1	28
α-helix	1135-1156	22
α-helix	1162-1178	17
α-helix	1185-1196	12
α-helix	1203-1214	12
β-strand	1217-1219	3	29
β-strand	1225-1227	3	29
α-helix	1248-1260	13
α-helix	1264-1275	12
α-helix	1290-1306	17
β-strand	1312-1317	6	25
β-strand	1322-1327	6	25
β-strand	1338-1340	3	23
β-strand	1346-1350	5	25
β-strand	1357-1365	9	23
β-strand	1367	1	26

Chain B: 27 helices, 55 β-strands

Element	Residues	Length	Sheet
α-helix	24-26	3
α-helix	28	1
β-strand	29	1	72
α-helix	30-35	6
β-strand	42-47	6	73
β-strand	48	1	72
α-helix	54-57	4
α-helix	61-64	4
β-strand	68-73	6	73
α-helix	79-81	3
β-strand	87	1	74
α-helix	89-92	4
β-strand	99-100	2	75
β-strand	103	1	76
β-strand	104	1	74
β-strand	122	1	76
β-strand	125-126	2	75
β-strand	144-145	2	77
β-strand	151-152	2	77
α-helix	154-156	3
β-strand	185-186	2	78
α-helix	187	1
α-helix	191-193	3
β-strand	195	1	79
β-strand	196-197	2	80
β-strand	207	1	79
β-strand	209	1	81
β-strand	220-223	4	78
β-strand	226-231	6	78
α-helix	232-233	2
β-strand	236-238	3	82
β-strand	244-245	2	83
β-strand	253	1	35
β-strand	258-277	20	35
β-strand	293-319	27	35
β-strand	320-321	2	83
β-strand	324-327	4	82
β-strand	334	1	81
α-helix	336-343	8
α-helix	351-361	11
β-strand	364-365	2	80
β-strand	368-371	4	82
β-strand	374-406	33	35
β-strand	413-444	32	35
α-helix	450-452	3
α-helix	453-458	6
α-helix	459-461	3
α-helix	467-478	12
β-strand	482-485	4	82
β-strand	489	1	80
α-helix	490-493	4
α-helix	500-517	18
α-helix	520-522	3
α-helix	524-526	3
β-strand	531-535	5	84
β-strand	538-542	5	84
α-helix	570	1
β-strand	571	1	85
α-helix	572-576	5
β-strand	583-586	4	86
β-strand	587	1	85
β-strand	606-609	4	86
β-strand	629	1	29
β-strand	644-645	2	87
β-strand	655	1	88
β-strand	661-662	2	87
α-helix	663	1
β-strand	667-668	2	89
β-strand	670	1	88
α-helix	672-673	2
β-strand	677-680	4	90
β-strand	684-685	2	89
β-strand	686	1	91
α-helix	687	1
β-strand	692	1	91
β-strand	697-700	4	90
β-strand	703-705	3	92
α-helix	706-707	2
β-strand	716	1	93
β-strand	721-723	3	92
β-strand	727-729	3	93
β-strand	743-745	3	93

Chain C: 17 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	12-13	2	30
α-helix	14-23	10
β-strand	28-32	5	31
β-strand	35-37	3	30
β-strand	39	1	32
β-strand	51-55	5	31
β-strand	71-72	2	33
α-helix	73	1
β-strand	79-80	2	33
α-helix	82-84	3
α-helix	112	1
β-strand	113	1	34
α-helix	114-115	2
α-helix	120-122	3
β-strand	123-126	4	35
β-strand	131-135	5	35
β-strand	137	1	36
β-strand	150-151	2	37
β-strand	154-155	2	37
β-strand	156	1	34
β-strand	162-167	6	35
β-strand	171-177	7	35
β-strand	180-200	21	35
β-strand	203	1	35
β-strand	211-252	42	35
α-helix	258	1
β-strand	259	1	36
α-helix	260	1
α-helix	261-268	8
α-helix	276-286	11
β-strand	289-335	47	35
β-strand	338-368	31	35
β-strand	373-374	2	35
α-helix	379-384	6
α-helix	396-402	7
β-strand	407-415	9	35
α-helix	416-418	3
α-helix	428-445	18
α-helix	452-453	2
β-strand	459-463	5	32
β-strand	466-470	5	32
β-strand	475-476	2	38
β-strand	482-483	2	38
α-helix	490-492	3
α-helix	496-501	6
β-strand	506-507	2	39
β-strand	533-534	2	39

Chain D: 22 helices, 49 β-strands

Element	Residues	Length	Sheet
β-strand	26	1	40
β-strand	29	1	41
α-helix	32-36	5
β-strand	54	1	41
β-strand	56	1	42
β-strand	57	1	40
α-helix	78-84	7
β-strand	89	1	43
β-strand	97	1	43
α-helix	99-101	3
α-helix	116-118	3
α-helix	126-129	4
α-helix	137-141	5
β-strand	142	1	44
β-strand	144	1	45
β-strand	154	1	44
β-strand	156	1	46
β-strand	167-168	2	47
β-strand	177-178	2	47
β-strand	192-202	11	35
β-strand	205-222	18	35
β-strand	226-248	23	35
β-strand	250-251	2	35
β-strand	253-254	2	48
β-strand	255	1	35
β-strand	261	1	49
β-strand	272	1	46
α-helix	274-281	8
α-helix	289-299	11
β-strand	302-304	3	45
β-strand	308	1	49
β-strand	313-314	2	48
β-strand	317-342	26	35
β-strand	348-369	22	35
β-strand	371-373	3	35
β-strand	376-377	2	48
α-helix	385-390	6
α-helix	398-399	2
α-helix	400-411	12
β-strand	421-423	3	45
α-helix	424-427	4
α-helix	434-451	18
α-helix	458-460	3
α-helix	461-463	3
β-strand	465-468	4	50
β-strand	472	1	42
β-strand	473-476	4	50
α-helix	477-478	2
β-strand	482	1	51
β-strand	488	1	51
α-helix	503-506	4
α-helix	508-510	3
α-helix	532-536	5
α-helix	547-551	5
α-helix	552-556	5
β-strand	571	1	52
α-helix	573-575	3
β-strand	580-582	3	53
β-strand	589	1	52
β-strand	594-595	2	54
β-strand	597-599	3	53
β-strand	604-606	3	55
β-strand	611-613	3	54
β-strand	619-620	2	54
β-strand	625-627	3	55
β-strand	640-641	2	56
β-strand	654-656	3	57
β-strand	658-659	2	56
β-strand	670-672	3	57
β-strand	673	1	58
β-strand	679	1	58

Chain E: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	24-27	4
β-strand	29-37	9	59
α-helix	41-45	5
α-helix	47-49	3
β-strand	53-60	8	59
β-strand	63-72	10	59
β-strand	75-85	11	59
β-strand	91-94	4	59
β-strand	103-110	8	59
β-strand	115-122	8	59
β-strand	125-132	8	59
α-helix	137-138	2
α-helix	139-151	13
α-helix	156-158	3
β-strand	159-161	3	59

Chain F: 13 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	10-11	2	60
α-helix	13-21	9
β-strand	26-30	5	61
β-strand	33-35	3	60
α-helix	41-43	3
β-strand	49-53	5	61
β-strand	70-71	2	62
β-strand	78-79	2	62
α-helix	81-83	3
β-strand	115	1	63
α-helix	119-122	4
β-strand	124-127	4	64
β-strand	132-136	5	64
β-strand	138	1	65
β-strand	148-150	3	63
β-strand	160-161	2	66
β-strand	166-167	2	66
β-strand	176-178	3	63
β-strand	182-184	3	64
β-strand	190-220	31	35
β-strand	234	1	67
β-strand	239-259	21	35
β-strand	262-267	6	35
β-strand	270-273	4	64
β-strand	280	1	65
α-helix	282-289	8
α-helix	297-307	11
β-strand	310-316	7	64
β-strand	319-347	29	35
β-strand	350	1	68
β-strand	351	1	67
β-strand	354-355	2	69
β-strand	359-360	2	69
β-strand	364	1	68
β-strand	367-394	28	35
α-helix	400-403	4
α-helix	410-422	13
α-helix	424-426	3
β-strand	428-433	6	64
α-helix	436-439	4
α-helix	447-463	17
α-helix	470-471	2
β-strand	479-481	3	70
β-strand	484-486	3	70
α-helix	512-517	6
β-strand	527-529	3	71
β-strand	549-551	3	71

Chain G: 12 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	34	1	94
β-strand	39	1	94
α-helix	84	1
β-strand	85	1	95
α-helix	86	1
β-strand	91	1	95
β-strand	162-164	3	96
β-strand	171-173	3	96
β-strand	178-182	5	97
β-strand	187-215	29	35
β-strand	218-219	2	35
β-strand	243-280	38	35
β-strand	283-287	5	97
α-helix	296-303	8
α-helix	311-320	10
β-strand	324-326	3	98
β-strand	328-332	5	97
β-strand	334-370	37	35
β-strand	373-374	2	99
β-strand	375-408	34	35
α-helix	413-423	11
α-helix	432-443	12
β-strand	446-447	2	97
β-strand	452-454	3	98
α-helix	460	1
α-helix	466-483	18
α-helix	496	1
β-strand	497-498	2	100
β-strand	501	1	101
β-strand	504	1	101
β-strand	507-508	2	100
α-helix	509-510	2
α-helix	516-518	3
α-helix	531-533	3

Chains H, I, J, V and X: 13 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	34	1	107
β-strand	39	1	107
α-helix	59-60	2
α-helix	84	1
β-strand	85	1	108
α-helix	86	1
β-strand	91	1	108
β-strand	162-164	3	109
β-strand	171-173	3	109
β-strand	178-182	5	35
β-strand	187-222	36	35
β-strand	244-287	44	35
α-helix	296-303	8
α-helix	311-321	11
β-strand	324-369	46	35
β-strand	374-408	35	35
α-helix	413-423	11
α-helix	432-443	12
β-strand	446-447	2	35
β-strand	451-454	4	35
α-helix	455-457	3
α-helix	460	1
α-helix	466-483	18
α-helix	496	1
β-strand	497-498	2	110
β-strand	501	1	111
β-strand	504	1	111
β-strand	507-508	2	110
α-helix	516-518	3
α-helix	531-533	3

5 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C5,Complement C5	A	protein	1580	Homo sapiens	P01031 (AlphaFold model)
Complement component C8 beta chain	C	protein	537	Homo sapiens	P07358 (AlphaFold model)
Complement component C7	D	protein	821	Homo sapiens	P10643 (AlphaFold model)
Complement component C8 gamma chain	E	protein	182	Homo sapiens	P07360 (AlphaFold model)
Complement component C8 alpha chain	F	protein	554	Homo sapiens	P07357
Complement component C6	B	protein	913	Homo sapiens	P13671
Complement component C9	G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X	protein	538	Homo sapiens	P02748

Sequence of entity 1 (A), FASTA

>6H03_1 Complement C5,Complement C5 (chains A)
QEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYPDKKFSYSSGHVHLSSENK
FQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPITYDNGFLFIHTDKPVYTPD
QSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHIGIISFPDFKIPSNPRYGM
WTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGYKNFKNFEITIKARYFYNK
VVTEADVYITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVTFDSETAVKELSYYSLEDL
NNKYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATPLFLKPGIPYPIKVQVKDS
LDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASFVLNLPSGVTVLEFNVKTD
APDLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGEHLNIIVTPKSPYIDKITH
YNYLILSKGKIIHFGTREKFSDASYQSINIPVTQNMVPSSRLLVYYIVTGEQTAELVSDS
VWLNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWVALAAVDSAVYGVQRGAKK
PLERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNANADDSQENDEPCKEILLHMKT
LLPVSKPEIRSYFPESWLWEVHLVPRRKQLQFALPDSLTTWEIQGVGISNTGICVADTVK
AKVFKDVFLEMNIPYSVVRGEQIQLKGTVYNYRTSGMQFCVKMSAVEGICTSESPVIDHQ
GTKSSKCVRQKVEGSSSHLVTFTVLPLEIGLHNINFSLETWFGKEILVKTLRVVPEGVKR
ESYSGVTLDPRGIYGTISRRKEFPYRIPLDLVPKTEIKRILSVKGLLVGEILSAVLSQEG
INILTHLPKGSAEAELMSVVPVFYVFHYLETGNHWNIFHSDPLIEKQKLKKKLKEGMLSI
MSYRNADYSYSVWKGGSASTWLTAFALRVLGQVNKYVEQNQNSICNSLLWLVENYQLDNG
SFKENSQYQPIKLQGTLPVEARENSLYLTAFTVIGIRKAFDICPLVKIDTALIKADNFLL
ENTLPAQSTFTLAISAYALSLGDKTHPQFRSIVSALKREALVKGNPPIYRFWKDNLQHKD
SSVPNTGTARMVETTAYALLTSLNLKDINYVNPVIKWLSEEQRYGGGFYSTQDTINAIEG
LTEYSLLVKQLRLSMDIDVSYKHKGALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGL
ATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSDYKRIVACASYKPSREESS
SGSSHAVMDISLPTGISANEEDLKALVEGVDQLFTDYQIKDGHVILQLNSIPSSDFLCVR
FRIFELFEVGFLSPATFTVYEYHRPDKQCTMFYSTSNIKIQKVCEGAACKCVEADCGQMQ
EELDLTISAETRKQTACKPEIAYAYKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDS
EITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSS
CQAFLANLDEFAEDIFLNGC

Sequence of entity 2 (C), FASTA

>6H03_2 Complement component C8 beta chain (chains C)
SVDVTLMPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNR
PCRSQVRCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGS
LASGINLFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEY
ESYSDFERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLH
ARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIY
EYTLVMNKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRN
KRDTMVEDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELV
TATDFAYSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLAC
EVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS

Sequence of entity 3 (D), FASTA

>6H03_3 Complement component C7 (chains D)
SSPVNCQWDFYAPWSECNGCTKTQTRRRSVAVYGQYGGQPCVGNAFETQSCEPTRGCPTE
EGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCEDSERRPSCDIDKPPPNIELTGN
GYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLSGNVLSYTFQVKINNDFNYEFYN
STWSYVKHTSTEHTSSSRKRSFFRSSSSSSRSYTSHTNEIHKGKSYQLLVVENTVEVAQF
INNNPEFLQLAEPFWKELSHLPSLYDYSAYRRLIDQYGTHYLQSGSLGGEYRVLFYVDSE
KLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENALKAASGTQNNVLRGEPFIRGGGA
GFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQKLTPLYELVKEVPCASVKKLYLK
WALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPYTFGAACEQGVLVGNQAGGVDGG
WSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETTESTQCEDEELEHLRLLEPHCFP
LSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCNEGYSLIGNPVARCGEDLRWLVG
EMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCSGGMSLEGPSAFLCGSSLKWSPE
MKNARCVQKENPLTQAVPKCQRWEKLQNSRCVCKMPYECGPSLDVCAQDERSKRILPLTV
CKMHVLHCQGRNYTLTGRDSCTLPASAEKACGACPLWGKCDAESSKCVCREASECEEEGF
SICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAAETQ

Sequence of entity 4 (E), FASTA

>6H03_4 Complement component C8 gamma chain (chains E)
QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQ
GTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYL
ERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEV
RR

Sequence of entity 5 (F), FASTA

>6H03_5 Complement component C8 alpha chain (chains F)
AATPAAVTCQLSNWSEWTDCFPCQDKKYRHRSLLQPNKFGGTICSGDIWDQASCSSSTTC
VRQAQCGQDFQCKETGRCLKRHLVCNGDQDCLDGSDEDDCEDVRAIDEDCSQYEPIPGSQ
KAALGYNILTQEDAQSVYDASYYGGQCETVYNGEWRELRYDSTCERLYYGDDEKYFRKPY
NFLKYHFEALADTGISSEFYDNANDLLSKVKKDKSDSFGVTIGIGPAGSPLLVGVGVSHS
QDTSFLNELNKYNEKKFIFTRIFTKVQTAHFKMRKDDIMLDEGMLQSLMELPDQYNYGMY
AKFINDYGTHYITSGSMGGIYEYILVIDKAKMESLGITSRDITTCFGGSLGIQYEDKINV
GGGLSGDHCKKFGGGKTERARKAMAVEDIISRVRGGSSGWSGGLAQNRSTITYRSWGRSL
KYNPVVIDFEMQPIHEVLRHTSLGPLEAKRQNLRRALDQYLMEFNACRCGPCFNNGVPIL
EGTSCRCQCRLGSLGAACEQTQTEGAKADGSWSCWSSWSVCRAGIQERRRECDNPAPQNG
GASCPGRKVQTQAC

Sequence of entity 6 (B), FASTA

>6H03_6 Complement component C6 (chains B)
CFCDHYAWTQWTSCSKTCNSGTQSRHRQIVVDKYYQENFCEQICSKQETRECNWQRCPIN
CLLGDFGPWSDCDPCIEKQSKVRSVLRPSQFGGQPCTAPLVAFQPCIPSKLCKIEEADCK
NKFRCDSGRCIARKLECNGENDCGDNSDERDCGRTKAVCTRKYNPIPSVQLMGNGFHFLA
GEPRGEVLDNSFTGGICKTVKSSRTSNPYRVPANLENVGFEVQTAEDDLKTDFYKDLTSL
GHNENQQGSFSSQGGSSFSVPIFYSSKRSENINHNSAFKQAIQASHKKDSSFIRIHKVMK
VLNFTTKAKDLHLSDVFLKALNHLPLEYNSALYSRIFDDFGTHYFTSGSLGGVYDLLYQF
SSEELKNSGLTEEEAKHCVRIETKKRVLFAKKTKVEHRCTTNKLSEKHEGSFIQGAEKSI
SLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENPAVIDFELAPIVDLVRNIPCAV
TKRNNLRKALQEYAAKFDPCQCAPCPNNGRPTLSGTECLCVCQSGTYGENCEKQSPDYKS
NAVDGQWGCWSSWSTCDATYKRSRTRECNNPAPQRGGKRCEGEKRQEEDCTFSIMENNGQ
PCINDDEEMKEVDLPEIEADSGCPQPVPPENGFIRNEKQLYLVGEDVEISCLTGFETVGY
QYFRCLPDGTWRQGDVECQRTECIKPVVQEVLTITPFQRLYRIGESIELTCPKGFVVAGP
SRYTCQGNSWTPPISNSLTCEKDTLTKLKGHCQLGQKQSGSECICMSPEEDCSHHSEDLC
VFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDGRQLEWGLERTRLSSNSTKKES
CGYDTCYDWEKCSASTSKCVCLLPPQCFKGGNQLYCVKMGSSTSEKTLNICEVGTIRCAN
RKMEILHPGKCLA

Sequence of entity 7 (G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X), FASTA

>6H03_7 Complement component C9 (chains G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X)
QYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQMFRSRSIEVFGQFNGKRCTDA
VGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCNGDNDCGDFSDEDDCESEPRPP
CRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGLCNRDRDGNTLTYYRRPWNVAS
LIYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAISLKFTPTETNKAEQCCEETASS
ISLHGKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVKGEIHLGRFVMRNRDVVLTTTFVD
DIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGLYELIYVLDKASMKRKGVELKDIKRCL
GYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSENLIDDVVSLIRGGTRKYAFELK
EKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLVPVKMKNAHLKKQNLERAIEDY
INEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACEISKQKISEGLPALEFPNEK

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	37

Primary citation

CryoEM reveals how the complement membrane attack complex ruptures lipid bilayers. Menny, A., Serna, M., Boyd, C.M. et al. Nat Commun (2018) 9:5316-5316. DOI 10.1038/s41467-018-07653-5 · PubMed

Other PDB entries of the same protein (UniProt P01031 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Y6C 2.0 Å, X-ray structure analysis of human Complement Component 5 TE domain in complex with the…
5B71 2.11 Å, Crystal structure of complement C5 in complex with SKY59
4UU9 2.12 Å, Crystal structure of the human c5a in complex with MEDI7814 a neutralising antibody
7AD7 2.3 Å, Crystal structure of human complement C5 in complex with the K8 bovine knob domain…
5B4P 2.4 Å, Complex structure of human C5a and its binding repebody
4P39 2.4 Å, Crystal structure of the human C5aR antagonist C5a-A8
7OP0 2.57 Å, Crystal structure of complement C5 in complex with chemically synthesized K92 knob domain.
3HQA 2.59 Å, Crystal structure of human desarg-C5A
5HCC 2.59 Å, Ternary complex of human Complement C5 with Ornithodoros moubata OmCI and Dermacentor…
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
6RPT 2.7 Å, Structure of tick complement inhibitor CirpT1 complexed with macroglobubulin domain 4 of…
7AD6 2.75 Å, Crystal structure of human complement C5 in complex with the K92 bovine knob domain…

Browse structure collections

About this viewer

MolViewer shows 6H03 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.