6H4B: ORF026

A polyamorous repressor: deciphering the evolutionary strategy used by the phage-inducible chromosomal islands to spread in nature. Determined by X-ray diffraction at 2.9 Å resolution. Released 28 Aug 2019.

Method: X-ray diffraction
Resolution: 2.9 Å
Organisms: Staphylococcus virus 69, Staphylococcus aureus
Chains: 2
Atoms: 1,727
Mol. weight: 34.43 kDa
Released: 28 Aug 2019

Explore 6H4B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6H4B contains 13 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	10-21	12
α-helix	29-45	17
α-helix	61-82	22
α-helix	105-116	12
α-helix	123-136	14
α-helix	143-156	14

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	179-180	2
α-helix	181-194	14
α-helix	207-228	22
α-helix	232-238	7
α-helix	242-244	3
α-helix	245-249	5
α-helix	250-259	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ORF026	A	protein	202	Staphylococcus virus 69	Q4ZDP4
Orf20	B	protein	96	Staphylococcus aureus	Q9F0J8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6H4B_1 ORF026 (chains A)
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMTNTLTIDQLQELLQIQKEFDDRIPT
LNLRDSKIAYVVEFFEWFNTLETFKNWKKKPGKPLDVQLDELADMLAFGLSIANQSGVSL
KTLEKLIPSTLGKVYFNTSSIMKDFMEDFVYFGLGEEDSLSLPLNIAYNLYSIDQLIDAY
KKKMKRNHERQDGTADAGKGYV

Sequence of entity 2 (B), FASTA

>6H4B_2 Orf20 (chains B)
GPGKKREVTIEEIGEFHEKYLKLLFTNLETHNDRKKALAEIEKLKEESIYLGEKLRLVPN
HHYDAIKGKPMYKLYLYEYPDRLEHQKKIILEKDTN

Primary citation

The structure of a polygamous repressor reveals how phage-inducible chromosomal islands spread in nature. Rafael Ciges-Tomas, J., Alite, C., Humphrey, S. et al. Nat Commun (2019) 10:3676-3676. DOI 10.1038/s41467-019-11504-2 · PubMed

Other PDB entries of the same protein (UniProt Q4ZDP4), best resolution first:

5MIL 2.1 Å, Pirating conserved phage mechanisms promotes promiscuous staphylococcal pathogenicity…

Browse structure collections

About this viewer

MolViewer shows 6H4B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.