Crystal structure of human 14-3-3 beta in complex with CFTR R-domain peptide pS753-pS768. Determined by X-ray diffraction at 1.86 Å resolution. Released 24 Oct 2018.
Explore 6HEP in 3D Show helices and sheets RCSB PDB PDBe
6HEP contains 56 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-17 | 13 | |
| α-helix | 21-32 | 12 | |
| α-helix | 37-39 | 3 | |
| α-helix | 40-70 | 31 | |
| α-helix | 75-102 | 28 | |
| α-helix | 103-107 | 5 | |
| α-helix | 108-110 | 3 | |
| α-helix | 114-134 | 21 | |
| α-helix | 137-161 | 25 | |
| α-helix | 167-178 | 12 | |
| α-helix | 179-183 | 5 | |
| α-helix | 187-205 | 19 | |
| α-helix | 210-213 | 4 | |
| α-helix | 214-231 | 18 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 0-2 | 3 | |
| α-helix | 5-17 | 13 | |
| α-helix | 21-33 | 13 | |
| α-helix | 37-39 | 3 | |
| α-helix | 40-69 | 30 | |
| α-helix | 75-102 | 28 | |
| α-helix | 103-107 | 5 | |
| α-helix | 108-110 | 3 | |
| α-helix | 114-134 | 21 | |
| α-helix | 137-161 | 25 | |
| α-helix | 167-178 | 12 | |
| α-helix | 179-183 | 5 | |
| α-helix | 187-202 | 16 | |
| α-helix | 205-207 | 3 | |
| α-helix | 210-231 | 22 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-17 | 13 | |
| α-helix | 21-32 | 12 | |
| α-helix | 37-38 | 2 | |
| α-helix | 40-69 | 30 | |
| α-helix | 75-102 | 28 | |
| α-helix | 103-107 | 5 | |
| α-helix | 114-132 | 19 | |
| α-helix | 138-161 | 24 | |
| α-helix | 167-178 | 12 | |
| α-helix | 179-183 | 5 | |
| α-helix | 187-205 | 19 | |
| α-helix | 210-213 | 4 | |
| α-helix | 214-229 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 0-2 | 3 | |
| α-helix | 5-17 | 13 | |
| α-helix | 21-33 | 13 | |
| α-helix | 37-39 | 3 | |
| α-helix | 40-70 | 31 | |
| α-helix | 80-102 | 23 | |
| α-helix | 103-107 | 5 | |
| α-helix | 108-110 | 3 | |
| α-helix | 114-134 | 21 | |
| α-helix | 137-161 | 25 | |
| α-helix | 167-178 | 12 | |
| α-helix | 179-183 | 5 | |
| α-helix | 187-202 | 16 | |
| α-helix | 215-230 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 14-3-3 protein beta/alpha | A, B, C, D | protein | 235 | Homo sapiens | P31946 (AlphaFold model) |
| Cystic fibrosis transmembrane conductance regulator | E, F | protein | 28 | Homo sapiens | P13569 (AlphaFold model) |
>6HEP_1 14-3-3 protein beta/alpha (chains A, B, C, D) MGSMTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGAR RSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESK VFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFS VFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTS
>6HEP_2 Cystic fibrosis transmembrane conductance regulator (chains E, F) AILPRISVISTGPTLQARRRQSVLNLMT
| ID | Name | Formula | Copies |
|---|---|---|---|
| ETE | 2-{2-[2-2-(methoxy-ethoxy)-ethoxy]-ethoxy}-ethanol | C9 H20 O5 | 2 |
A Thermodynamic Model for Multivalency in 14-3-3 Protein-Protein Interactions. Stevers, L.M., de Vink, P.J., Ottmann, C. et al. J Am Chem Soc (2018) 140:14498-14510. DOI 10.1021/jacs.8b09618 · PubMed
Other PDB entries of the same protein (UniProt P31946 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6HEP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.