6HIQ: 5-hydroxytryptamine receptor 3A

Mouse serotonin 5-HT3 receptor, serotonin-bound, I2 conformation. Determined by electron microscopy at 3.2 Å resolution. Released 7 Nov 2018.

Method: Electron microscopy
Resolution: 3.2 Å
Organism: Mus musculus
Chains: 5
Atoms: 16,110
Mol. weight: 267.09 kDa
Ligands: SRO, NAG
Released: 7 Nov 2018

Explore 6HIQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6HIQ contains 70 α-helices and 60 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D and E: 14 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	12-19	8
β-strand	37-52	16	1
β-strand	57-69	13	1
β-strand	85-89	5	1
α-helix	90-92	3
β-strand	98-100	3	2
β-strand	103-105	3	1
α-helix	110-112	3
β-strand	114-118	5	1
β-strand	122-134	13	1
β-strand	146-149	4	2
β-strand	153-155	3	2
β-strand	163-167	5	1
α-helix	171-175	5
β-strand	187-199	13	2
β-strand	207-218	12	2
α-helix	224-227	4
α-helix	229-240	12
α-helix	241-243	3
α-helix	246-248	3
α-helix	251-268	18
α-helix	282-307	26
α-helix	315-317	3
α-helix	318-331	14
α-helix	402-446	45
α-helix	450-459	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5-hydroxytryptamine receptor 3A	A, B, C, D, E	protein	452	Mus musculus	P23979 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>6HIQ_1 5-hydroxytryptamine receptor 3A (chains A, B, C, D, E)
QPALLRLSDHLLANYKKGVRPVRDWRKPTTVSIDVIMYAILNVDEKNQVLTTYIWYRQYW
TDEFLQWTPEDFDNVTKLSIPTDSIWVPDILINEFVDVGKSPNIPYVYVHHRGEVQNYKP
LQLVTACSLDIYNFPFDVQNCSLTFTSWLHTIQDINITLWRSPEEVRSDKSIFINQGEWE
LLEVFPQFKEFSIDISNSYAEMKFYVIIRRRPLFYAVSLLLPSIFLMVVDIVGFCLPPDS
GERVSFKITLLLGYSVFLIIVSDTLPATAIGTPLIGVYFVVCMALLVISLAETIFIVRLV
HKQDLQRPVPDWLRHLVLDRIAWILCLGEQPMAHRPPATFQANKTDDCSGSDLLPAMGNH
CSHVGGPQDLEKTPRGRGSPLPPPREASLAVRGLLQELSSIRHFLEKRDEMREVARDWLR
VGYVLDRLLFRIYLLAVLAYSITLVTLWSIWH

Ligands and cofactors

ID	Name	Formula	Copies
SRO	Serotonin	C10 H12 N2 O	5
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	5

Primary citation

Conformational transitions of the serotonin 5-HT3receptor. Polovinkin, L., Hassaine, G., Perot, J. et al. Nature (2018) 563:275-279. DOI 10.1038/s41586-018-0672-3 · PubMed

Other PDB entries of the same protein (UniProt P23979 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8FRX 2.7 Å, Full-length mouse 5-HT3A receptor in complex with SMP100, pre-activated
8FRZ 2.75 Å, Full-length mouse 5-HT3A receptor in complex with serotonin, pre-activated
8FSB 2.75 Å, Full-length mouse 5-HT3A receptor in complex with serotonin, open-like
6Y5A 2.8 Å, Serotonin-bound 5-HT3A receptor in Salipro
6Y1Z 2.82 Å, Mouse serotonin 5HT3 receptor in complex with palonosetron
6NP0 2.92 Å, Cryo-EM structure of 5HT3A receptor in presence of granisetron
6W1J 2.92 Å, Cryo-EM structure of 5HT3A receptor in presence of Alosetron
8FRW 2.92 Å, Full-length mouse 5-HT3A receptor in complex with ALB148471, pre-activated
8CC7 3.0 Å, Mouse serotonin 5-HT3A receptor in complex with PZ-1939
8AW2 3.01 Å, Mouse serotonin 5-HT3A receptor in complex with vortioxetine
6W1M 3.06 Å, Cryo-EM structure of 5HT3A receptor in presence of Ondansetron
6Y5B 3.1 Å, 5-HT3A receptor in Salipro (apo, asymmetric)

Browse structure collections

About this viewer

MolViewer shows 6HIQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.