6HJ3: Xray structure of GLIC

Xray structure of GLIC in complex with fumarate. Determined by X-ray diffraction at 2.7 Å resolution. Released 11 Sept 2019.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Gloeobacter violaceus
Chains: 5
Atoms: 13,140
Mol. weight: 194.94 kDa
Ligands: PLC, LMT, FUM
Released: 11 Sept 2019

Explore 6HJ3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6HJ3 contains 74 α-helices and 60 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 15 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	14-15	2
β-strand	16-31	16	1
β-strand	36-48	13	1
α-helix	50-52	3
α-helix	56-59	4
β-strand	64-65	2	1
α-helix	68-70	3
β-strand	76-78	3	2
β-strand	81	1	1
β-strand	86-94	9	1
β-strand	99-111	13	1
α-helix	116-118	3
β-strand	123-133	11	2
α-helix	134-135	2
β-strand	140-144	5	1
α-helix	146-148	3
β-strand	150-151	2	1
β-strand	160-176	17	2
β-strand	179-192	14	2
α-helix	197	1
α-helix	198-202	5
α-helix	203-213	11
α-helix	214-217	4
α-helix	221-244	24
α-helix	254-281	28
α-helix	285-314	30

Chains B and D: 15 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	14-15	2
β-strand	16-31	16	3
β-strand	36-48	13	3
α-helix	50-52	3
α-helix	56-59	4
β-strand	64-65	2	3
α-helix	68-70	3
β-strand	76-78	3	4
β-strand	81	1	3
β-strand	86-94	9	3
β-strand	99-111	13	3
α-helix	116-118	3
β-strand	123-133	11	4
α-helix	134-135	2
β-strand	140-144	5	3
α-helix	146-148	3
β-strand	150-151	2	3
β-strand	160-176	17	4
β-strand	179-192	14	4
α-helix	197	1
α-helix	198-202	5
α-helix	203-212	10
α-helix	213-217	5
α-helix	221-244	24
α-helix	254-281	28
α-helix	285-314	30

Chain E: 14 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	14-15	2
β-strand	16-31	16	9
β-strand	36-48	13	9
α-helix	50-52	3
α-helix	56-59	4
β-strand	64-65	2	9
α-helix	68-70	3
β-strand	76-78	3	10
β-strand	81	1	9
β-strand	86-94	9	9
β-strand	99-111	13	9
β-strand	123-133	11	10
α-helix	134-135	2
β-strand	140-144	5	9
α-helix	146-148	3
β-strand	150-151	2	9
β-strand	160-176	17	10
β-strand	179-192	14	10
α-helix	197	1
α-helix	198-202	5
α-helix	203-212	10
α-helix	213-217	5
α-helix	221-244	24
α-helix	254-281	28
α-helix	285-314	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proton-gated ion channel	A, B, C, D, E	protein	317	Gloeobacter violaceus	Q7NDN8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>6HJ3_1 Proton-gated ion channel (chains A, B, C, D, E)
GQDMVSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSG
VRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYP
FDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRL
ESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNI
LVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFP
VVFLLANIILAFLFFGF

Ligands and cofactors

ID	Name	Formula	Copies
PLC	Diundecyl phosphatidyl choline	C32 H65 N O8 P	15
LMT	Dodecyl-beta-D-maltoside	C24 H46 O11	6
FUM	Fumaric acid	C4 H4 O4	5

Water and common crystallization additives (CL, NA) are not listed.

Primary citation

Structural evidence for the binding of monocarboxylates and dicarboxylates at pharmacologically relevant extracellular sites of a pentameric ligand-gated ion channel. Fourati, Z., Sauguet, L., Delarue, M. Acta Crystallogr D Struct Biol (2020) 76:668-675. DOI 10.1107/S205979832000772X · PubMed

Other PDB entries of the same protein (UniProt Q7NDN8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9LBD 2.14 Å, Cryo-EM structure of nanodisc (PE:PS:PC) reconstituted GLIC F116A mutant at pH 2.5
6HZW 2.22 Å, THE GLIC PENTAMERIC LIGAND-GATED ION CHANNEL 2.22 resolution
3IGQ 2.3 Å, Crystal structure of the extracellular domain of a bacterial pentameric ligand-gated ion…
6F0U 2.35 Å, GLIC mutant E35A
4HFI 2.4 Å, The GLIC pentameric Ligand-Gated Ion Channel at 2.4 A resolution
6F0R 2.5 Å, GLIC mutant E82Q
6F0Z 2.5 Å, GLIC mutant D88N
6HJZ 2.5 Å, Xray structure of GLIC in complex with succinate
6HZ1 2.5 Å, The glic pentameric ligand-gated ion channel mutant E243C
6HY5 2.58 Å, The glic pentameric ligand-gated ion channel mutant Q193C
3TLW 2.6 Å, The GLIC pentameric Ligand-Gated Ion Channel Loop2-21' oxidized mutant in a…
5IUX 2.6 Å, GLIC-V135C bimane labelled X-ray structure

Browse structure collections

About this viewer

MolViewer shows 6HJ3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.