6HKW: Human SDS22

Crystal structure of human SDS22. Determined by X-ray diffraction at 3.09 Å resolution. Released 30 Jan 2019.

Method: X-ray diffraction
Resolution: 3.09 Å
Organism: Homo sapiens
Chains: 5
Atoms: 12,600
Mol. weight: 211.67 kDa
Released: 30 Jan 2019

Explore 6HKW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6HKW contains 31 α-helices and 80 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	65	1	1
α-helix	66-68	3
α-helix	69-74	6
β-strand	80-82	3	2
β-strand	88	1	1
α-helix	94-96	3
β-strand	102-104	3	2
β-strand	124-126	3	2
β-strand	146-148	3	2
β-strand	168-170	3	2
β-strand	190-192	3	2
β-strand	212-214	3	2
β-strand	234-236	3	2
β-strand	256-258	3	2
β-strand	278-280	3	2
β-strand	300-302	3	2
α-helix	311-317	7
β-strand	325-327	3	2
α-helix	332-335	4
α-helix	339-346	8
β-strand	352-353	2	2
β-strand	356-357	2	2

Chains B, C and E: 6 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	65	1	3
α-helix	66-68	3
α-helix	69-74	6
β-strand	80-82	3	4
β-strand	88	1	3
α-helix	94-96	3
β-strand	102-104	3	4
β-strand	124-126	3	4
β-strand	146-148	3	4
β-strand	168-170	3	4
β-strand	190-192	3	4
β-strand	212-214	3	4
β-strand	234-236	3	4
β-strand	256-258	3	4
β-strand	278-280	3	4
β-strand	300-302	3	4
α-helix	311-319	9
β-strand	325-327	3	4
α-helix	332-335	4
α-helix	339-346	8
β-strand	352-353	2	4
β-strand	356-357	2	4

Chain D: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	65	1	7
α-helix	66-68	3
α-helix	69-74	6
β-strand	80-82	3	8
β-strand	88	1	7
α-helix	94-96	3
β-strand	102-104	3	8
β-strand	124-126	3	8
β-strand	146-148	3	8
β-strand	168-170	3	8
β-strand	190-192	3	8
α-helix	203-206	4
β-strand	212-214	3	8
β-strand	234-236	3	8
β-strand	256-258	3	8
β-strand	278-280	3	8
β-strand	300-302	3	8
α-helix	311-319	9
β-strand	325-327	3	8
α-helix	332-335	4
α-helix	339-346	8
β-strand	352-353	2	8
β-strand	356-357	2	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein phosphatase 1 regulatory subunit 7	A, B, C, D, E	protein	363	Homo sapiens	Q15435 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>6HKW_1 Protein phosphatase 1 regulatory subunit 7 (chains A, B, C, D, E)
GEFMAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEE
DPEEEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLE
ELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKIS
KIENLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSM
QSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTE
LQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATF
VRF

Primary citation

Structure-Guided Exploration of SDS22 Interactions with Protein Phosphatase PP1 and the Splicing Factor BCLAF1. Heroes, E., Van der Hoeven, G., Choy, M.S. et al. Structure (2019) 27:507-518.e5. DOI 10.1016/j.str.2018.12.002 · PubMed

Other PDB entries of the same protein (UniProt Q15435 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6OBN 2.7 Å, The crystal structure of coexpressed SDS22:PP1 complex
6OBP 2.7 Å, Reconstituted PP1 holoenzyme
6MKY 2.9 Å, Human SDS22
8U5G 3.2 Å, Crystal structure of the co-expressed SDS22:PP1:I3 complex
8B5R 6.1 Å, p97-p37-SPI substrate complex

Browse structure collections

About this viewer

MolViewer shows 6HKW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.