Structure of Beclin1 LIR (S96E) motif bound to GABARAP. Determined by X-ray diffraction at 1.61 Å resolution. Released 27 Feb 2019.
Explore 6HOK in 3D Show helices and sheets RCSB PDB PDBe
6HOK contains 6 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-8 | 5 | |
| α-helix | 11-24 | 14 | |
| β-strand | 28-35 | 8 | 1 |
| α-helix | 42-44 | 3 | |
| β-strand | 48-52 | 5 | 1 |
| β-strand | 56 | 1 | 2 |
| α-helix | 57-68 | 12 | |
| β-strand | 77-79 | 3 | 1 |
| β-strand | 80 | 1 | 3 |
| β-strand | 83 | 1 | 3 |
| α-helix | 84-86 | 3 | |
| β-strand | 90 | 1 | 2 |
| α-helix | 91-98 | 8 | |
| β-strand | 105-110 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beclin-1,Gamma-aminobutyric acid receptor-associated protein | A | protein | 127 | Homo sapiens | O95166 (AlphaFold model), Q14457 (AlphaFold model) |
>6HOK_1 Beclin-1,Gamma-aminobutyric acid receptor-associated protein (chains A) SANEFTLIGEASDGSMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLD KKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFL YIAYSDE
Members of the autophagy class III phosphatidylinositol 3-kinase complex I interact with GABARAP and GABARAPL1 via LIR motifs. Birgisdottir, A.B., Mouilleron, S., Bhujabal, Z. et al. Autophagy (2019) 15:1333-1355. DOI 10.1080/15548627.2019.1581009 · PubMed
Other PDB entries of the same protein (UniProt O95166 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6HOK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.