6HYO: ULK1 LIR motif

Structure of ULK1 LIR motif bound to GABARAP. Determined by X-ray diffraction at 1.07 Å resolution. Released 8 May 2019.

Method: X-ray diffraction
Resolution: 1.07 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,414
Mol. weight: 16.73 kDa
Released: 8 May 2019

Explore 6HYO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6HYO contains 8 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	-12--10	3
α-helix	4-8	5
α-helix	11-24	14
β-strand	28-35	8	1
α-helix	36	1
α-helix	42-44	3
β-strand	48-52	5	1
β-strand	56	1	2
α-helix	57-67	11
β-strand	77-79	3	1
β-strand	80	1	3
β-strand	83	1	3
α-helix	84-86	3
β-strand	90	1	2
α-helix	91-98	8
β-strand	105-110	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase ULK1,Gamma-aminobutyric acid receptor-associated protein	A	protein	137	Homo sapiens	O75385 (AlphaFold model), O95166 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6HYO_1 Serine/threonine-protein kinase ULK1,Gamma-aminobutyric acid receptor-associated protein (chains A)
GPTMGTDDFVMVPAQFPGGSMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKAR
IGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHE
EDFFLYIAYSDESVYGL

Primary citation

Molecular determinants regulating selective binding of autophagy adapters and receptors to ATG8 proteins. Wirth, M., Zhang, W., Razi, M. et al. Nat Commun (2019) 10:2055-2055. DOI 10.1038/s41467-019-10059-6 · PubMed

Other PDB entries of the same protein (UniProt O75385 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4WNO 1.56 Å, Structure of ULK1 bound to an inhibitor
6MNH 1.73 Å, ULK1 Unc-51 like autophagy activating kinase in complex with inhibitor BTC
5CI7 1.74 Å, Structure of ULK1 bound to a selective inhibitor
6QAS 1.75 Å, Crystal structure of ULK1 in complexed with PF-03814735
8P5I 1.83 Å, Kinase domain of mutant human ULK1 in complex with compound XMD-17-51
8P5L 1.84 Å, Kinase domain of mutant human ULK1 in complex with compound MRT67307
4WNP 1.88 Å, Structure of ULK1 bound to a potent inhibitor
8P5H 1.94 Å, Kinase domain of mutant human ULK1 in complex with compound CCT241533
9SE8 2.0 Å, Crystal structure of ULK1 in complex with inhibitor SBP-5147
8P5G 2.02 Å, Kinase domain of wild type human ULK1 in complex with compound CCT241533
9F32 2.1 Å, Crystal structure of ULK1 with a covalent compound GCL 99
8P5J 2.16 Å, Kinase domain of mutant human ULK1 in complex with compound WZ4003

Browse structure collections

About this viewer

MolViewer shows 6HYO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.