6HUJ: PDB entry 6HUJ

CryoEM structure of human full-length heteromeric alpha1beta3gamma2L GABA(A)R in complex with picrotoxin, GABA and megabody Mb38. Determined by electron microscopy at 3.04 Å resolution. Released 2 Jan 2019.

Method: Electron microscopy
Resolution: 3.04 Å
Organisms: Bos taurus, Homo sapiens, Lama glama
Chains: 6
Atoms: 15,255
Mol. weight: 336.99 kDa
Ligands: PIO, RI5, ABU
Released: 2 Jan 2019

Explore 6HUJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6HUJ contains 62 α-helices and 85 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	11-21	11
β-strand	39-50	12	1
β-strand	54	1	1
β-strand	59-71	13	1
α-helix	73-75	3
β-strand	83	1	2
α-helix	88-91	4
β-strand	99-101	3	3
β-strand	104	1	1
β-strand	108-109	2	1
β-strand	117-121	5	1
β-strand	122	1	2
β-strand	126-138	13	1
β-strand	150-159	10	3
β-strand	167-171	5	1
α-helix	175-178	4
β-strand	179-181	3	1
β-strand	193-204	12	3
β-strand	209-220	12	3
α-helix	224-226	3
α-helix	227-231	5
α-helix	232-243	12
α-helix	244-246	3
α-helix	252-275	24
α-helix	285-307	23
α-helix	308-310	3
α-helix	391-414	24

Chain B: 11 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	9-19	11
α-helix	35	1
β-strand	36-51	16	4
β-strand	56-68	13	4
β-strand	81-83	3	4
α-helix	85-89	5
β-strand	96-98	3	5
β-strand	101-106	6	4
β-strand	114-118	5	4
β-strand	123-135	13	4
β-strand	147-148	2	6
β-strand	151-156	6	5
β-strand	164-168	5	4
β-strand	175-176	2	4
β-strand	186-188	3	6
β-strand	192-199	8	5
β-strand	204-211	8	5
β-strand	214-216	3	6
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-235	9
α-helix	238-240	3
α-helix	247-271	25
α-helix	282-303	22
α-helix	304-308	5
α-helix	420-445	26

Chain C: 11 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	27-35	9
β-strand	51-62	12	7
β-strand	71-83	13	7
α-helix	85-87	3
β-strand	95-98	4	7
β-strand	111-113	3	8
β-strand	116	1	7
β-strand	120-121	2	7
β-strand	129-134	6	7
β-strand	138-150	13	7
β-strand	163-171	9	8
β-strand	179-190	12	7
β-strand	201-214	14	8
β-strand	219-231	13	8
α-helix	234-236	3
α-helix	237-241	5
α-helix	242-251	10
α-helix	252-256	5
α-helix	262-278	17
α-helix	282-284	3
α-helix	295-318	24
α-helix	319-323	5
α-helix	410-432	23

Chain D: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	14-20	7
β-strand	39-49	11	9
β-strand	53-54	2	9
β-strand	59-71	13	9
α-helix	73-75	3
β-strand	83-86	4	9
α-helix	90-92	3
β-strand	99-101	3	10
β-strand	104	1	9
β-strand	108-109	2	9
β-strand	117-122	6	9
β-strand	126-138	13	9
β-strand	150-159	10	10
β-strand	167-171	5	9
α-helix	175-178	4
β-strand	180-181	2	9
β-strand	191-205	15	10
β-strand	208-221	14	10
α-helix	224-226	3
α-helix	227-231	5
α-helix	232-243	12
α-helix	244-246	3
α-helix	252-272	21
α-helix	285-307	23
α-helix	308-310	3
α-helix	391-414	24

Chain E: 14 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	10-19	10
α-helix	28	1
α-helix	35	1
β-strand	36-51	16	11
β-strand	56-68	13	11
α-helix	70-72	3
β-strand	82-83	2	11
α-helix	85-90	6
β-strand	96-98	3	12
β-strand	101-106	6	11
β-strand	114-118	5	11
β-strand	123-135	13	11
α-helix	140-142	3
β-strand	147-148	2	13
β-strand	151-156	6	12
β-strand	164-168	5	11
α-helix	171-173	3
β-strand	176	1	11
β-strand	186-188	3	13
β-strand	192-199	8	12
β-strand	204-211	8	12
β-strand	214-216	3	13
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-236	10
α-helix	237-240	4
α-helix	247-269	23
α-helix	280-307	28
α-helix	421-445	25

Chain G: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	14
β-strand	11-12	2	15
β-strand	424-431	8	14
β-strand	439-446	8	3
β-strand	450-457	8	3
β-strand	462-465	4	3
β-strand	474-478	5	14
β-strand	483-488	6	14
α-helix	493-495	3
β-strand	497-498	2	3
β-strand	501-504	4	3
α-helix	513-515	3
β-strand	518-519	2	3
β-strand	520	1	14
β-strand	524-525	2	3
β-strand	526-527	2	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit alpha-1,Gamma-aminobutyric acid receptor subunit alpha-1	A, D	protein	464	Bos taurus, Homo sapiens	P08219 (AlphaFold model), P14867 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit beta-3	B, E	protein	473	Homo sapiens	P28472 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit gamma-2	C	protein	495	Homo sapiens	P18507 (AlphaFold model)
Megabody Mb38	G	protein	539	Lama glama

Sequence of entity 1 (A, D), FASTA

>6HUJ_1 Gamma-aminobutyric acid receptor subunit alpha-1,Gamma-aminobutyric acid receptor subunit alpha-1 (chains A, D)
MKKSPGLSDYLWAWTLFLSTLTGRSYGDYKDDDDKQPSLQDELKDNTTVFTRILDRLLDG
YDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLR
LNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLED
FPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQS
STGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLT
MTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPE
KPKKVKDPLIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKT
FNSVSKIDRLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ

Sequence of entity 2 (B, E), FASTA

>6HUJ_2 Gamma-aminobutyric acid receptor subunit beta-3 (chains B, E)
MCSGLLELLLPIWLSWTLGTRGSEPRSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPP
VCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPD
TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE
SYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK
RNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKI
PYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNR
VDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRS
LPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYVN

Sequence of entity 3 (C), FASTA

>6HUJ_3 Gamma-aminobutyric acid receptor subunit gamma-2 (chains C)
MSSPNIWSTGSSVYSTPVFSQKMTVWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPK
VPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQT
WYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLY
TLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQF
SFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDA
VPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFV
SNRKPSKDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGK
DCASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYLGGSGG
SGGSGKTETSQVAPA

Sequence of entity 4 (G), FASTA

>6HUJ_4 Megabody Mb38 (chains G)
QVQLQESGGGLVQTKTTTSVIDTTNDAQNLLTQAQTIVNTLKDYCPILIAKSSSSNGGTN
NANTPSWQTAGGGKNSCATFGAEFSAASDMINNAQKIVQETQQLSANQPKNITQPHNLNL
NSPSSLTALAQKMLKNAQSQAEILKLANQVESDFNKLSSGHLKDYIGKCDASAISSANMT
MQNQKNNWGNGCAGVEETQSLLKTSAADFNNQTPQINQAQNLANTLIQELGNNPFRASGG
GSGGGGSGKLSDTYEQLSRLLTNDNGTNSKTSAQAINQAVNNLNERAKTLAGGTTNSPAY
QATLLALRSVLGLWNSMGYAVICGGYTKSPGENNQKDFHYTDENGNGTTINCGGSTNSNG
THSYNGTNTLKADKNVSLSIEQYEKIHEAYQILSKALKQAGLAPLNSKGEKLEAHVTTSK
YGSLRVSCAASGRTFTTYIMAWFRQAPGKEREFLAAMDQGRIQYYGDSVRGRFTISRDYA
KNSVDLQLDGLRPEDTAVYYCAAGAGFWGLRTASSYHYWGQGTQVTVSSHHHHHHEPEA

Ligands and cofactors

ID	Name	Formula	Copies
PIO	[(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-d…	C25 H49 O19 P3	2
RI5	(1aR,2aR,3S,6R,6aS,8aS,8bR,9R)-2a-hydroxy-8b-methyl-9-(prop-1-en-2-yl)hexahydro…	C15 H16 O6	1
ABU	Gamma-amino-butanoic acid	C4 H9 N O2	2

Primary citation

GABAAreceptor signalling mechanisms revealed by structural pharmacology. Masiulis, S., Desai, R., Uchanski, T. et al. Nature (2019) 565:454-459. DOI 10.1038/s41586-018-0832-5 · PubMed

Other PDB entries of the same protein (UniProt P08219 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HUG 3.1 Å, CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with…
6HUO 3.26 Å, CryoEM structure of human full-length heteromeric alpha1beta3gamma2L GABA(A)R in complex…
6HUP 3.58 Å, CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with…
6HUK 3.69 Å, CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with…

Browse structure collections

About this viewer

MolViewer shows 6HUJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.