6HUJ: PDB entry 6HUJ
CryoEM structure of human full-length heteromeric alpha1beta3gamma2L GABA(A)R in complex with picrotoxin, GABA and megabody Mb38. Determined by electron microscopy at 3.04 Å resolution. Released 2 Jan 2019.
- Method
- Electron microscopy
- Resolution
- 3.04 Å
- Organisms
- Bos taurus, Homo sapiens, Lama glama
- Chains
- 6
- Atoms
- 15,255
- Mol. weight
- 336.99 kDa
- Ligands
- PIO, RI5, ABU
- Released
- 2 Jan 2019
Explore 6HUJ in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6HUJ contains 62 α-helices and 85 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 12 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 11-21 | 11 | |
| β-strand | 39-50 | 12 | 1 |
| β-strand | 54 | 1 | 1 |
| β-strand | 59-71 | 13 | 1 |
| α-helix | 73-75 | 3 | |
| β-strand | 83 | 1 | 2 |
| α-helix | 88-91 | 4 | |
| β-strand | 99-101 | 3 | 3 |
| β-strand | 104 | 1 | 1 |
| β-strand | 108-109 | 2 | 1 |
| β-strand | 117-121 | 5 | 1 |
| β-strand | 122 | 1 | 2 |
| β-strand | 126-138 | 13 | 1 |
| β-strand | 150-159 | 10 | 3 |
| β-strand | 167-171 | 5 | 1 |
| α-helix | 175-178 | 4 | |
| β-strand | 179-181 | 3 | 1 |
| β-strand | 193-204 | 12 | 3 |
| β-strand | 209-220 | 12 | 3 |
| α-helix | 224-226 | 3 | |
| α-helix | 227-231 | 5 | |
| α-helix | 232-243 | 12 | |
| α-helix | 244-246 | 3 | |
| α-helix | 252-275 | 24 | |
| α-helix | 285-307 | 23 | |
| α-helix | 308-310 | 3 | |
| α-helix | 391-414 | 24 | |
Chain B: 11 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-19 | 11 | |
| α-helix | 35 | 1 | |
| β-strand | 36-51 | 16 | 4 |
| β-strand | 56-68 | 13 | 4 |
| β-strand | 81-83 | 3 | 4 |
| α-helix | 85-89 | 5 | |
| β-strand | 96-98 | 3 | 5 |
| β-strand | 101-106 | 6 | 4 |
| β-strand | 114-118 | 5 | 4 |
| β-strand | 123-135 | 13 | 4 |
| β-strand | 147-148 | 2 | 6 |
| β-strand | 151-156 | 6 | 5 |
| β-strand | 164-168 | 5 | 4 |
| β-strand | 175-176 | 2 | 4 |
| β-strand | 186-188 | 3 | 6 |
| β-strand | 192-199 | 8 | 5 |
| β-strand | 204-211 | 8 | 5 |
| β-strand | 214-216 | 3 | 6 |
| α-helix | 219-221 | 3 | |
| α-helix | 222-226 | 5 | |
| α-helix | 227-235 | 9 | |
| α-helix | 238-240 | 3 | |
| α-helix | 247-271 | 25 | |
| α-helix | 282-303 | 22 | |
| α-helix | 304-308 | 5 | |
| α-helix | 420-445 | 26 | |
Chain C: 11 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 27-35 | 9 | |
| β-strand | 51-62 | 12 | 7 |
| β-strand | 71-83 | 13 | 7 |
| α-helix | 85-87 | 3 | |
| β-strand | 95-98 | 4 | 7 |
| β-strand | 111-113 | 3 | 8 |
| β-strand | 116 | 1 | 7 |
| β-strand | 120-121 | 2 | 7 |
| β-strand | 129-134 | 6 | 7 |
| β-strand | 138-150 | 13 | 7 |
| β-strand | 163-171 | 9 | 8 |
| β-strand | 179-190 | 12 | 7 |
| β-strand | 201-214 | 14 | 8 |
| β-strand | 219-231 | 13 | 8 |
| α-helix | 234-236 | 3 | |
| α-helix | 237-241 | 5 | |
| α-helix | 242-251 | 10 | |
| α-helix | 252-256 | 5 | |
| α-helix | 262-278 | 17 | |
| α-helix | 282-284 | 3 | |
| α-helix | 295-318 | 24 | |
| α-helix | 319-323 | 5 | |
| α-helix | 410-432 | 23 | |
Chain D: 12 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-20 | 7 | |
| β-strand | 39-49 | 11 | 9 |
| β-strand | 53-54 | 2 | 9 |
| β-strand | 59-71 | 13 | 9 |
| α-helix | 73-75 | 3 | |
| β-strand | 83-86 | 4 | 9 |
| α-helix | 90-92 | 3 | |
| β-strand | 99-101 | 3 | 10 |
| β-strand | 104 | 1 | 9 |
| β-strand | 108-109 | 2 | 9 |
| β-strand | 117-122 | 6 | 9 |
| β-strand | 126-138 | 13 | 9 |
| β-strand | 150-159 | 10 | 10 |
| β-strand | 167-171 | 5 | 9 |
| α-helix | 175-178 | 4 | |
| β-strand | 180-181 | 2 | 9 |
| β-strand | 191-205 | 15 | 10 |
| β-strand | 208-221 | 14 | 10 |
| α-helix | 224-226 | 3 | |
| α-helix | 227-231 | 5 | |
| α-helix | 232-243 | 12 | |
| α-helix | 244-246 | 3 | |
| α-helix | 252-272 | 21 | |
| α-helix | 285-307 | 23 | |
| α-helix | 308-310 | 3 | |
| α-helix | 391-414 | 24 | |
Chain E: 14 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 10-19 | 10 | |
| α-helix | 28 | 1 | |
| α-helix | 35 | 1 | |
| β-strand | 36-51 | 16 | 11 |
| β-strand | 56-68 | 13 | 11 |
| α-helix | 70-72 | 3 | |
| β-strand | 82-83 | 2 | 11 |
| α-helix | 85-90 | 6 | |
| β-strand | 96-98 | 3 | 12 |
| β-strand | 101-106 | 6 | 11 |
| β-strand | 114-118 | 5 | 11 |
| β-strand | 123-135 | 13 | 11 |
| α-helix | 140-142 | 3 | |
| β-strand | 147-148 | 2 | 13 |
| β-strand | 151-156 | 6 | 12 |
| β-strand | 164-168 | 5 | 11 |
| α-helix | 171-173 | 3 | |
| β-strand | 176 | 1 | 11 |
| β-strand | 186-188 | 3 | 13 |
| β-strand | 192-199 | 8 | 12 |
| β-strand | 204-211 | 8 | 12 |
| β-strand | 214-216 | 3 | 13 |
| α-helix | 219-221 | 3 | |
| α-helix | 222-226 | 5 | |
| α-helix | 227-236 | 10 | |
| α-helix | 237-240 | 4 | |
| α-helix | 247-269 | 23 | |
| α-helix | 280-307 | 28 | |
| α-helix | 421-445 | 25 | |
Chain G: 2 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-6 | 4 | 14 |
| β-strand | 11-12 | 2 | 15 |
| β-strand | 424-431 | 8 | 14 |
| β-strand | 439-446 | 8 | 3 |
| β-strand | 450-457 | 8 | 3 |
| β-strand | 462-465 | 4 | 3 |
| β-strand | 474-478 | 5 | 14 |
| β-strand | 483-488 | 6 | 14 |
| α-helix | 493-495 | 3 | |
| β-strand | 497-498 | 2 | 3 |
| β-strand | 501-504 | 4 | 3 |
| α-helix | 513-515 | 3 | |
| β-strand | 518-519 | 2 | 3 |
| β-strand | 520 | 1 | 14 |
| β-strand | 524-525 | 2 | 3 |
| β-strand | 526-527 | 2 | 15 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Gamma-aminobutyric acid receptor subunit alpha-1,Gamma-aminobutyric acid receptor subunit alpha-1 | A, D | protein | 464 | Bos taurus, Homo sapiens | P08219 (AlphaFold model), P14867 (AlphaFold model) |
| Gamma-aminobutyric acid receptor subunit beta-3 | B, E | protein | 473 | Homo sapiens | P28472 (AlphaFold model) |
| Gamma-aminobutyric acid receptor subunit gamma-2 | C | protein | 495 | Homo sapiens | P18507 (AlphaFold model) |
| Megabody Mb38 | G | protein | 539 | Lama glama | |
Sequence of entity 1 (A, D), FASTA
>6HUJ_1 Gamma-aminobutyric acid receptor subunit alpha-1,Gamma-aminobutyric acid receptor subunit alpha-1 (chains A, D)
MKKSPGLSDYLWAWTLFLSTLTGRSYGDYKDDDDKQPSLQDELKDNTTVFTRILDRLLDG
YDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLR
LNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLED
FPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQS
STGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLT
MTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPE
KPKKVKDPLIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKT
FNSVSKIDRLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
Sequence of entity 2 (B, E), FASTA
>6HUJ_2 Gamma-aminobutyric acid receptor subunit beta-3 (chains B, E)
MCSGLLELLLPIWLSWTLGTRGSEPRSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPP
VCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPD
TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE
SYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK
RNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKI
PYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNR
VDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRS
LPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYVN
Sequence of entity 3 (C), FASTA
>6HUJ_3 Gamma-aminobutyric acid receptor subunit gamma-2 (chains C)
MSSPNIWSTGSSVYSTPVFSQKMTVWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPK
VPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQT
WYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLY
TLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQF
SFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDA
VPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFV
SNRKPSKDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGK
DCASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYLGGSGG
SGGSGKTETSQVAPA
Sequence of entity 4 (G), FASTA
>6HUJ_4 Megabody Mb38 (chains G)
QVQLQESGGGLVQTKTTTSVIDTTNDAQNLLTQAQTIVNTLKDYCPILIAKSSSSNGGTN
NANTPSWQTAGGGKNSCATFGAEFSAASDMINNAQKIVQETQQLSANQPKNITQPHNLNL
NSPSSLTALAQKMLKNAQSQAEILKLANQVESDFNKLSSGHLKDYIGKCDASAISSANMT
MQNQKNNWGNGCAGVEETQSLLKTSAADFNNQTPQINQAQNLANTLIQELGNNPFRASGG
GSGGGGSGKLSDTYEQLSRLLTNDNGTNSKTSAQAINQAVNNLNERAKTLAGGTTNSPAY
QATLLALRSVLGLWNSMGYAVICGGYTKSPGENNQKDFHYTDENGNGTTINCGGSTNSNG
THSYNGTNTLKADKNVSLSIEQYEKIHEAYQILSKALKQAGLAPLNSKGEKLEAHVTTSK
YGSLRVSCAASGRTFTTYIMAWFRQAPGKEREFLAAMDQGRIQYYGDSVRGRFTISRDYA
KNSVDLQLDGLRPEDTAVYYCAAGAGFWGLRTASSYHYWGQGTQVTVSSHHHHHHEPEA
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| PIO | [(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-d… | C25 H49 O19 P3 | 2 |
| RI5 | (1aR,2aR,3S,6R,6aS,8aS,8bR,9R)-2a-hydroxy-8b-methyl-9-(prop-1-en-2-yl)hexahydro… | C15 H16 O6 | 1 |
| ABU | Gamma-amino-butanoic acid | C4 H9 N O2 | 2 |
Primary citation
GABAAreceptor signalling mechanisms revealed by structural pharmacology. Masiulis, S., Desai, R., Uchanski, T. et al. Nature (2019) 565:454-459. DOI 10.1038/s41586-018-0832-5 · PubMed
Other PDB entries of the same protein (UniProt P08219 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6HUG 3.1 Å, CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with…
- 6HUO 3.26 Å, CryoEM structure of human full-length heteromeric alpha1beta3gamma2L GABA(A)R in complex…
- 6HUP 3.58 Å, CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with…
- 6HUK 3.69 Å, CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with…
Browse structure collections
About this viewer
MolViewer shows 6HUJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.