6HUO: PDB entry 6HUO

CryoEM structure of human full-length heteromeric alpha1beta3gamma2L GABA(A)R in complex with alprazolam (Xanax), GABA and megabody Mb38. Determined by electron microscopy at 3.26 Å resolution. Released 2 Jan 2019.

Method: Electron microscopy
Resolution: 3.26 Å
Organisms: Bos taurus, Homo sapiens, Lama glama
Chains: 6
Atoms: 15,227
Mol. weight: 337 kDa
Ligands: ABU, PIO, 08H
Released: 2 Jan 2019

Explore 6HUO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6HUO contains 66 α-helices and 80 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	14-22	9
β-strand	39-49	11	1
β-strand	53-54	2	1
β-strand	59-71	13	1
α-helix	73-75	3
β-strand	83-86	4	1
α-helix	90-92	3
β-strand	99-101	3	2
β-strand	104	1	1
β-strand	108-109	2	1
β-strand	117-122	6	1
β-strand	126-138	13	1
α-helix	143-145	3
β-strand	150-159	10	2
β-strand	167-171	5	1
α-helix	175-177	3
β-strand	179-181	3	1
β-strand	193-203	11	2
β-strand	211-220	10	2
α-helix	224-226	3
α-helix	227-231	5
α-helix	232-241	10
α-helix	243-245	3
α-helix	252-274	23
α-helix	285-309	25
α-helix	387-390	4
α-helix	391-415	25

Chain B: 11 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	10-19	10
α-helix	35	1
β-strand	36-47	12	3
β-strand	57-68	12	3
α-helix	70-72	3
β-strand	82-83	2	3
α-helix	85-90	6
β-strand	96-98	3	4
β-strand	101-106	6	3
β-strand	116-118	3	3
β-strand	123-134	12	3
β-strand	147-156	10	4
β-strand	164-168	5	3
β-strand	176	1	3
β-strand	186-199	14	4
β-strand	204-216	13	4
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-235	9
α-helix	236-240	5
α-helix	247-270	24
α-helix	282-307	26
α-helix	420-445	26

Chain C: 11 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	27-34	8
α-helix	43	1
β-strand	51-62	12	5
β-strand	71-83	13	5
α-helix	85-87	3
β-strand	95-98	4	5
α-helix	103-105	3
β-strand	111-113	3	6
β-strand	116-121	6	5
β-strand	129-134	6	5
β-strand	138-150	13	5
β-strand	163-171	9	6
β-strand	179-190	12	5
β-strand	201-214	14	6
β-strand	219-231	13	6
α-helix	234-236	3
α-helix	237-241	5
α-helix	242-252	11
α-helix	253-256	4
α-helix	262-286	25
α-helix	295-321	27
α-helix	410-434	25

Chain D: 13 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	14-22	9
β-strand	39-45	7	7
β-strand	46-47	2	8
β-strand	49	1	7
α-helix	52	1
β-strand	53-54	2	7
β-strand	59-71	13	7
α-helix	73-75	3
β-strand	84-86	3	7
α-helix	90-92	3
β-strand	100-101	2	9
β-strand	104	1	7
β-strand	108-109	2	7
β-strand	117-121	5	7
β-strand	126-138	13	7
α-helix	143-145	3
β-strand	150-158	9	9
β-strand	167-171	5	7
α-helix	175-177	3
β-strand	180-181	2	8
β-strand	191-205	15	9
β-strand	208-221	14	9
α-helix	224-226	3
α-helix	227-231	5
α-helix	232-241	10
α-helix	244-246	3
α-helix	252-274	23
α-helix	285-307	23
α-helix	391-414	24

Chain E: 16 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	10-17	8
α-helix	28	1
α-helix	35	1
β-strand	36-51	16	10
β-strand	56-68	13	10
α-helix	70-72	3
β-strand	81-83	3	10
α-helix	85-90	6
β-strand	96-98	3	11
β-strand	101	1	10
β-strand	105-106	2	10
β-strand	114-118	5	10
β-strand	123-135	13	10
α-helix	140-142	3
β-strand	147-156	10	11
β-strand	164-168	5	10
α-helix	171-173	3
β-strand	176	1	10
β-strand	188-199	12	11
β-strand	204-215	12	11
α-helix	216-217	2
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-234	8
α-helix	235-240	6
α-helix	247-269	23
α-helix	280-303	24
α-helix	304-308	5
α-helix	421-445	25

Chain G: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	12
β-strand	5-7	3	13
β-strand	12	1	14
β-strand	424-429	6	13
β-strand	439-446	8	2
β-strand	450-457	8	2
β-strand	462-465	4	2
β-strand	474-478	5	13
β-strand	483-488	6	13
α-helix	493-495	3
β-strand	497-504	8	2
α-helix	513-515	3
β-strand	519	1	2
β-strand	520	1	12
β-strand	524-525	2	2
β-strand	527	1	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit alpha-1,Gamma-aminobutyric acid receptor subunit alpha-1	A, D	protein	464	Bos taurus, Homo sapiens	P08219 (AlphaFold model), P14867 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit beta-3	B, E	protein	473	Homo sapiens	P28472 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit gamma-2	C	protein	495	Homo sapiens	P18507 (AlphaFold model)
Megabody Mb38	G	protein	539	Lama glama

Sequence of entity 1 (A, D), FASTA

>6HUO_1 Gamma-aminobutyric acid receptor subunit alpha-1,Gamma-aminobutyric acid receptor subunit alpha-1 (chains A, D)
MKKSPGLSDYLWAWTLFLSTLTGRSYGDYKDDDDKQPSLQDELKDNTTVFTRILDRLLDG
YDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLR
LNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLED
FPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQS
STGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLT
MTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPE
KPKKVKDPLIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKT
FNSVSKIDRLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ

Sequence of entity 2 (B, E), FASTA

>6HUO_2 Gamma-aminobutyric acid receptor subunit beta-3 (chains B, E)
MCSGLLELLLPIWLSWTLGTRGSEPRSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPP
VCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPD
TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE
SYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK
RNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKI
PYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNR
VDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRS
LPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYVN

Sequence of entity 3 (C), FASTA

>6HUO_3 Gamma-aminobutyric acid receptor subunit gamma-2 (chains C)
MSSPNIWSTGSSVYSTPVFSQKMTVWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPK
VPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQT
WYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLY
TLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQF
SFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDA
VPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFV
SNRKPSKDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGK
DCASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYLGGSGG
SGGSGKTETSQVAPA

Sequence of entity 4 (G), FASTA

>6HUO_4 Megabody Mb38 (chains G)
QVQLQESGGGLVQTKTTTSVIDTTNDAQNLLTQAQTIVNTLKDYCPILIAKSSSSNGGTN
NANTPSWQTAGGGKNSCATFGAEFSAASDMINNAQKIVQETQQLSANQPKNITQPHNLNL
NSPSSLTALAQKMLKNAQSQAEILKLANQVESDFNKLSSGHLKDYIGKCDASAISSANMT
MQNQKNNWGNGCAGVEETQSLLKTSAADFNNQTPQINQAQNLANTLIQELGNNPFRASGG
GSGGGGSGKLSDTYEQLSRLLTNDNGTNSKTSAQAINQAVNNLNERAKTLAGGTTNSPAY
QATLLALRSVLGLWNSMGYAVICGGYTKSPGENNQKDFHYTDENGNGTTINCGGSTNSNG
THSYNGTNTLKADKNVSLSIEQYEKIHEAYQILSKALKQAGLAPLNSKGEKLEAHVTTSK
YGSLRVSCAASGRTFTTYIMAWFRQAPGKEREFLAAMDQGRIQYYGDSVRGRFTISRDYA
KNSVDLQLDGLRPEDTAVYYCAAGAGFWGLRTASSYHYWGQGTQVTVSSHHHHHHEPEA

Ligands and cofactors

ID	Name	Formula	Copies
ABU	Gamma-amino-butanoic acid	C4 H9 N O2	2
PIO	[(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-d…	C25 H49 O19 P3	2
08H	8-chloro-1-methyl-6-phenyl-4H-[1,2,4]triazolo[4,3-a][1,4]benzodiazepine	C17 H13 Cl N4	1

Primary citation

GABAAreceptor signalling mechanisms revealed by structural pharmacology. Masiulis, S., Desai, R., Uchanski, T. et al. Nature (2019) 565:454-459. DOI 10.1038/s41586-018-0832-5 · PubMed

Other PDB entries of the same protein (UniProt P08219 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HUJ 3.04 Å, CryoEM structure of human full-length heteromeric alpha1beta3gamma2L GABA(A)R in complex…
6HUG 3.1 Å, CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with…
6HUP 3.58 Å, CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with…
6HUK 3.69 Å, CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with…

Browse structure collections

About this viewer

MolViewer shows 6HUO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.