6HWE: Yeast 20S proteasome beta2-G45A mutant

Yeast 20S proteasome beta2-G45A mutant in complex with carfilzomib. Determined by X-ray diffraction at 2.3 Å resolution. Released 30 Jan 2019.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Saccharomyces cerevisiae S288C
Chains: 28
Atoms: 52,005
Mol. weight: 736.66 kDa
Ligands: GWZ, MG
Released: 30 Jan 2019

Explore 6HWE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6HWE contains 258 α-helices and 397 β-strands across 28 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains a and M: 7 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	6-8	3	9
β-strand	11-16	6	10
β-strand	19-25	7	10
β-strand	28-30	3	9
β-strand	33-36	4	9
β-strand	42-45	4	9
β-strand	49-56	8	9
α-helix	57-75	19
α-helix	87-88	2
α-helix	89-105	17
β-strand	112-119	8	9
β-strand	125-131	7	9
β-strand	136-137	2	9
β-strand	141-143	3	10
α-helix	146-156	11
α-helix	162-164	3
α-helix	170-187	18
β-strand	188	1	59
β-strand	194-201	8	10
β-strand	205-213	9	10
α-helix	220-224	5

Chains A and O: 13 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	1
β-strand	12	1	2
β-strand	18	1	2
α-helix	19-30	12
α-helix	32-33	2
β-strand	34-38	5	3
β-strand	43-48	6	3
β-strand	56-57	2	4
β-strand	65-68	4	5
β-strand	71-77	7	5
α-helix	79-93	15
α-helix	94-98	5
α-helix	99-101	3
α-helix	104-106	3
α-helix	107-120	14
β-strand	125	1	1
β-strand	127	1	6
α-helix	128-130	3
β-strand	132-140	9	5
β-strand	144-150	7	5
β-strand	156-158	3	5
β-strand	159	1	7
β-strand	161-164	4	3
α-helix	168-178	11
α-helix	185-199	15
β-strand	209-214	6	3
α-helix	219-221	3
β-strand	224-225	2	8
β-strand	235-237	3	3
α-helix	238-239	2
α-helix	240-248	9

Chain b: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	15
β-strand	11-17	7	15
β-strand	20-22	3	16
β-strand	25-28	4	16
β-strand	34-38	5	17
β-strand	41-47	7	17
α-helix	49-70	22
α-helix	73-74	2
α-helix	75-88	14
α-helix	90-92	3
β-strand	95-102	8	17
β-strand	108-113	6	17
β-strand	120-122	3	17
β-strand	124-127	4	15
α-helix	129-134	6
α-helix	135-141	7
α-helix	148-165	18
β-strand	166	1	56
β-strand	173-179	7	15
β-strand	182-188	7	15
α-helix	190-193	4

Chains B and P: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	2-5	4
β-strand	12	1	11
β-strand	18	1	11
α-helix	19-28	10
α-helix	32-33	2
β-strand	34-39	6	12
β-strand	42-48	7	12
β-strand	56	1	7
β-strand	65-67	3	13
β-strand	72-78	7	13
α-helix	80-101	22
α-helix	104-106	3
α-helix	107-123	17
β-strand	124	1	14
α-helix	128-130	3
β-strand	132-140	9	13
β-strand	144-150	7	13
β-strand	156-159	4	13
β-strand	161-164	4	12
α-helix	168-178	11
α-helix	185-199	15
α-helix	207-209	3
β-strand	210-216	7	12
β-strand	225-228	4	12
α-helix	229-230	2
α-helix	231-241	11

Chain C: 10 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	9	1	18
β-strand	15	1	18
α-helix	16-27	12
α-helix	29-30	2
β-strand	31-35	5	19
β-strand	40-45	6	19
β-strand	53	1	13
α-helix	59-60	2
β-strand	63-64	2	20
β-strand	69-75	7	20
α-helix	77-98	22
α-helix	101-103	3
α-helix	104-117	14
β-strand	124	1	14
α-helix	125-127	3
β-strand	129-135	7	20
β-strand	144-148	5	20
β-strand	154-156	3	20
β-strand	157	1	21
β-strand	159-162	4	19
α-helix	166-176	11
α-helix	186-198	13
β-strand	208-214	7	19
β-strand	218-221	4	19
α-helix	224-238	15

Chains D and R: 14 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	6	1
β-strand	7	1	22
α-helix	8	1
β-strand	13	1	22
α-helix	14-24	11
α-helix	27-28	2
β-strand	29-33	5	23
β-strand	38-43	6	23
β-strand	51	1	21
α-helix	53-55	3
β-strand	59-63	5	24
β-strand	66-72	7	24
α-helix	74-76	3
α-helix	77-95	19
α-helix	98-100	3
α-helix	101-112	12
β-strand	115	1	25
β-strand	126	1	25
β-strand	132-140	9	24
β-strand	144-150	7	24
β-strand	156-158	3	24
β-strand	159	1	26
β-strand	161-164	4	23
α-helix	168-178	11
α-helix	185-199	15
α-helix	203-204	2
β-strand	209-215	7	23
β-strand	219-222	4	23
α-helix	223-224	2
α-helix	225-240	16

Chains E and S: 11 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	19-30	12
α-helix	32-33	2
β-strand	34-38	5	27
β-strand	42-48	7	27
β-strand	51	1	28
β-strand	56	1	26
α-helix	57	1
β-strand	58	1	28
α-helix	59-60	2
β-strand	62-66	5	29
β-strand	69-75	7	29
α-helix	77-98	22
α-helix	101-103	3
α-helix	104-120	17
β-strand	121	1	30
β-strand	129-137	9	29
β-strand	140-146	7	29
β-strand	152-154	3	29
β-strand	155	1	31
β-strand	157-160	4	27
α-helix	164-178	15
α-helix	185-196	12
α-helix	197-199	3
β-strand	210-216	7	27
β-strand	219-224	6	27
α-helix	226-232	7

Chains F and T: 11 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	10-12	3
α-helix	18-29	12
β-strand	33-37	5	32
β-strand	41-49	9	32
β-strand	55	1	31
α-helix	56	1
β-strand	64-66	3	33
β-strand	70-76	7	33
α-helix	78-99	22
α-helix	102-104	3
α-helix	105-118	14
β-strand	125	1	30
α-helix	126-128	3
β-strand	130-138	9	33
β-strand	141-147	7	33
β-strand	153-155	3	33
β-strand	156	1	34
β-strand	158-161	4	32
α-helix	165-178	14
α-helix	185-199	15
α-helix	200-203	4
β-strand	208-216	9	32
β-strand	224-226	3	32
α-helix	229-243	15

9 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proteasome subunit alpha type-2	A, O	protein	250	Saccharomyces cerevisiae S288C	P23639 (AlphaFold model)
Proteasome subunit alpha type-3	B, P	protein	258	Saccharomyces cerevisiae S288C	P23638 (AlphaFold model)
Proteasome subunit alpha type-4	C, Q	protein	254	Saccharomyces cerevisiae S288C	P40303 (AlphaFold model)
Proteasome subunit alpha type-5	D, R	protein	260	Saccharomyces cerevisiae S288C	P32379 (AlphaFold model)
Proteasome subunit alpha type-6	E, S	protein	234	Saccharomyces cerevisiae S288C	P40302
Probable proteasome subunit alpha type-7	F, T	protein	288	Saccharomyces cerevisiae S288C	P21242
Proteasome subunit alpha type-1	G, U	protein	252	Saccharomyces cerevisiae S288C	P21243
Proteasome subunit beta type-2	H, V	protein	232	Saccharomyces cerevisiae S288C	P25043
Proteasome subunit beta type-3	I, W	protein	205	Saccharomyces cerevisiae S288C	P25451
Proteasome subunit beta type-4	J, X	protein	198	Saccharomyces cerevisiae S288C	P22141
Proteasome subunit beta type-5	K, Y	protein	212	Saccharomyces cerevisiae S288C	P30656
Proteasome subunit beta type-6	L, Z	protein	222	Saccharomyces cerevisiae S288C	P23724

2 more molecules are not listed.

Sequence of entity 1 (A, O), FASTA

>6HWE_1 Proteasome subunit alpha type-2 (chains A, O)
MTDRYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSET
LSKVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQE
ATQSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWN
DELELEDAIHIALLTLKESVEGEFNGDTIELAIIGDENPDLLGYTGIPTDKGPRFRKLTS
QEINDRLEAL

Sequence of entity 2 (B, P), FASTA

>6HWE_2 Proteasome subunit alpha type-3 (chains B, P)
MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
TSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ
GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
KDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILV
KTGITKKDEDEEADEDMK

Sequence of entity 3 (C, Q), FASTA

>6HWE_3 Proteasome subunit alpha type-4 (chains C, Q)
MSGYDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRIT
PSKVSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRY
TQSGGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYD
RKEPPATVEECVKLTVRSLLEVVQTGAKNIEITVVKPDSDIVALSSEEINQYVTQIEQEK
QEQQEQDKKKKSNH

Sequence of entity 4 (D, R), FASTA

>6HWE_4 Proteasome subunit alpha type-5 (chains D, R)
MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLE
SDSIEKIVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLA
LRFGEGASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQ
AELLNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQLSCITKQDGFKIYDNEKTAELI
KELKEKEAAESPEEADVEMS

Sequence of entity 5 (E, S), FASTA

>6HWE_5 Proteasome subunit alpha type-6 (chains E, S)
MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSSYQ
KKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQKNT
QSYGGRPYGVGLLIIGYDKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTLDTFI
KIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIYDGEAVAKYI

Sequence of entity 6 (F, T), FASTA

>6HWE_6 Probable proteasome subunit alpha type-7 (chains F, T)
MTSIGTGYDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLV
PQKNVKIQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYV
QAHTLYNSVRPFGVSTIFGGVDKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLV
DHHPEGLSAREAVKQAAKIIYLAHEDNKEKDFELEISWCSLSETNGLHKFVKGDLLQEAI
DFAQKEINGDDDEDEDDSDNVMSSDDENAPVATNANATTDQEGDIHLE

Sequence of entity 7 (G, U), FASTA

>6HWE_7 Proteasome subunit alpha type-1 (chains G, U)
MSGAAAASAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVP
DKLLDPTTVSYIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKR
MANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITT
NLENHFKKSKIDHINEESWEKVVEFAITHMIDALGTEFSKNDLEVGVATKDKFFTLSAEN
IEERLVAIAEQD

Sequence of entity 8 (H, V), FASTA

>6HWE_8 Proteasome subunit beta type-2 (chains H, V)
TTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAAAGTAADTEAVTQLIG
SNIELHSLYTSREPRVVSALQMLKQHLFKYQGHIGAYLIVAGVDPTGSHLFSIHAHGSTD
VGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQAGIWNDLGSGSNVDVCVMEI
GKDAEYLRNYLTPNVREEKQKSYKFPRGTTAVLKESIVNICDIQEEQVDITA

Sequence of entity 9 (I, W), FASTA

>6HWE_9 Proteasome subunit beta type-3 (chains I, W)
MSDPSSINGGIVVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYGHVFLGITGLATDV
TTLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYERRFGPYFVGPVVAGINSKSGKPF
IAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPEDLFETISQALLNAADRDAL
SGWGAVVYIIKKDEVVKRYLKMRQD

Sequence of entity 10 (J, X), FASTA

>6HWE_10 Proteasome subunit beta type-4 (chains J, X)
MDIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYI
QANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQID
YLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVI
VKIVDKDGIRQVDDFQAQ

Sequence of entity 11 (K, Y), FASTA

>6HWE_11 Proteasome subunit beta type-5 (chains K, Y)
TTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWETWLG
SQCRLHELREKERISVAAASKILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGT
RLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSGGSVNLYHV
TEDGWIYHGNHDVGELFWKVKEEEGSFNNVIG

Sequence of entity 12 (L, Z), FASTA

>6HWE_12 Proteasome subunit beta type-6 (chains L, Z)
QFNPYGDNGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAAD
GDALVKRFKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGKG
AVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSVEEV
IKLVRDSFTSATERHIQVGDGLEILIVTKDGVRKEFYELKRD

Ligands and cofactors

ID	Name	Formula	Copies
GWZ	(2~{S})-~{N}-[(2~{S})-1-[[(3~{R},4~{S})-2,6-dimethyl-2,3-bis(oxidanyl)heptan-4-…	C40 H61 N5 O7	6
MG	Magnesium ion	Mg	8

Water and common crystallization additives (SO4, MES, CL) are not listed.

Primary citation

Structure-Based Design of Inhibitors Selective for Human Proteasome beta 2c or beta 2i Subunits. Xin, B.T., Huber, E.M., de Bruin, G. et al. J Med Chem (2019) 62:1626-1642. DOI 10.1021/acs.jmedchem.8b01884 · PubMed

Other PDB entries of the same protein (UniProt P23639 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1RYP 1.9 Å, Crystal structure of the 20S proteasome from yeast at 2.4 Å resolution
8RVQ 2.02 Å, 20S proteasome from pre1-1
4R17 2.1 Å, Ligand-induced aziridine-formation at subunit beta5 of the yeast 20S proteasome
8RVL 2.14 Å, Proteasomal late precursor complex from pre1-1
8U7U 2.16 Å, Proteasome 20S Core Particle from Beta 3 D205 deletion
1G65 2.25 Å, Crystal structure of epoxomicin:20s proteasome reveals a molecular basis for selectivity…
8RVP 2.28 Å, Proteasomal late precursor complex from pre1-1, state 2
4QVP 2.3 Å, yCP beta5-M45T mutant in complex with bortezomib
5CZ4 2.3 Å, Yeast 20S proteasome at 2.3 A resolution
9GBK 2.39 Å, Blm10-20S proteasome complex from pre1-1
1G0U 2.4 Å, A gated channel into the proteasome core particle
3NZJ 2.4 Å, Crystal structure of yeast 20S proteasome in complex with ligand 2a

Browse structure collections

About this viewer

MolViewer shows 6HWE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.