Structure of PCM1 LIR motif bound to GABARAP. Determined by X-ray diffraction at 1.86 Å resolution. Released 8 May 2019.
Explore 6HYM in 3D Show helices and sheets RCSB PDB PDBe
6HYM contains 18 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | -4--3 | 2 | |
| α-helix | 4-8 | 5 | |
| α-helix | 11-24 | 14 | |
| β-strand | 28-35 | 8 | 1 |
| α-helix | 36 | 1 | |
| α-helix | 42-44 | 3 | |
| β-strand | 48-52 | 5 | 1 |
| β-strand | 56 | 1 | 2 |
| α-helix | 57-68 | 12 | |
| β-strand | 77-79 | 3 | 1 |
| β-strand | 80 | 1 | 3 |
| β-strand | 83 | 1 | 3 |
| α-helix | 84-86 | 3 | |
| β-strand | 90 | 1 | 2 |
| α-helix | 91-98 | 8 | |
| β-strand | 105-110 | 6 | 1 |
| α-helix | 114-116 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | -4--3 | 2 | |
| α-helix | 4-7 | 4 | |
| α-helix | 11-24 | 14 | |
| β-strand | 28-35 | 8 | 4 |
| α-helix | 36 | 1 | |
| α-helix | 42-44 | 3 | |
| β-strand | 48-52 | 5 | 4 |
| β-strand | 56 | 1 | 5 |
| α-helix | 57-67 | 11 | |
| β-strand | 77-79 | 3 | 4 |
| β-strand | 80 | 1 | 6 |
| β-strand | 83 | 1 | 6 |
| α-helix | 84-86 | 3 | |
| β-strand | 90 | 1 | 5 |
| α-helix | 91-98 | 8 | |
| β-strand | 105-110 | 6 | 4 |
| α-helix | 114-116 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Pericentriolar material 1 protein,Gamma-aminobutyric acid receptor-associated protein | A, B | protein | 138 | Homo sapiens | O95166 (AlphaFold model), Q15154 (AlphaFold model) |
>6HYM_1 Pericentriolar material 1 protein,Gamma-aminobutyric acid receptor-associated protein (chains A, B) GPTMGDEEDFVKVEDLPLKGSMKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKA RIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHH EEDFFLYIAYSDESVYGL
Molecular determinants regulating selective binding of autophagy adapters and receptors to ATG8 proteins. Wirth, M., Zhang, W., Razi, M. et al. Nat Commun (2019) 10:2055-2055. DOI 10.1038/s41467-019-10059-6 · PubMed
Other PDB entries of the same protein (UniProt O95166 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6HYM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.