6I0Q: BTB domain of KCTD16 hexamer

Crystal structure of BTB domain of KCTD16 hexamer. Determined by X-ray diffraction at 2.3 Å resolution. Released 2 Oct 2019.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 1
Atoms: 876
Mol. weight: 12.18 kDa
Released: 2 Oct 2019

Explore 6I0Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6I0Q contains 6 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	1
β-strand	34-39	6	1
α-helix	40-43	4
α-helix	50-55	6
β-strand	67	1	1
β-strand	73-75	3	1
α-helix	79-91	13
α-helix	96-97	2
α-helix	103-112	10
α-helix	116-121	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BTB/POZ domain-containing protein KCTD16	A	protein	103	Homo sapiens	Q68DU8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6I0Q_1 BTB/POZ domain-containing protein KCTD16 (chains A)
SFPEVVELNVGGQVYFTRHSTLISIPHSLLWKMFSPKRDTANDLAKDSKGRFFIDRDGFL
FRYILDYLRDRQVVLPDHFPEKGRLKREAEYFQLPDLVKLLTP

Primary citation

Targeting the gamma-Aminobutyric Acid Type B (GABAB) Receptor Complex: Development of Inhibitors Targeting the K+Channel Tetramerization Domain (KCTD) Containing Proteins/GABABReceptor Protein-Protein Interaction. Sereikaite, V., Fritzius, T., Kasaragod, V.B. et al. J Med Chem (2019) 62:8819-8830. DOI 10.1021/acs.jmedchem.9b01087 · PubMed

Other PDB entries of the same protein (UniProt Q68DU8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6QB7 2.23 Å, Structure of the H1 domain of human KCTD16
6OCR 2.28 Å, Crystal structure of human KCTD16 T1 domain
6OCP 2.35 Å, Crystal structure of a human GABAB receptor peptide bound to KCTD16 T1
5A15 2.76 Å, Crystal structure of the BTB domain of human KCTD16
6OCT 2.8 Å, Crystal structure of human KCTD16 T1 domain
6M8R 3.2 Å, Crystal structure of the KCTD16 BTB domain in complex with GABAB2 peptide

Browse structure collections

About this viewer

MolViewer shows 6I0Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.