6OCP: Human GABAB receptor peptide

Crystal structure of a human GABAB receptor peptide bound to KCTD16 T1. Determined by X-ray diffraction at 2.35 Å resolution. Released 10 Apr 2019.

Method: X-ray diffraction
Resolution: 2.35 Å
Organism: Homo sapiens
Chains: 18
Atoms: 12,561
Mol. weight: 205.35 kDa
Released: 10 Apr 2019

Explore 6OCP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6OCP contains 103 α-helices and 61 β-strands across 18 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and D: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	1
β-strand	34-39	6	1
α-helix	40-43	4
α-helix	50-55	6
β-strand	67	1	1
α-helix	72	1
β-strand	73-75	3	1
α-helix	82-91	10
α-helix	103-112	10
α-helix	116-121	6

Chains B, C, G, I and L: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	2
β-strand	34-39	6	2
α-helix	40-43	4
α-helix	50-55	6
β-strand	67	1	2
α-helix	72	1
β-strand	73-75	3	2
α-helix	82-91	10
α-helix	95-97	3
α-helix	103-112	10
α-helix	116-121	6

Chain E: 6 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	5
β-strand	34-39	6	5
α-helix	40-43	4
α-helix	50-55	6
β-strand	67	1	5
α-helix	72	1
β-strand	73-75	3	5
α-helix	82-91	10
α-helix	103-112	10
α-helix	116-122	7

Chain F: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	6
β-strand	34-39	6	6
α-helix	40-43	4
α-helix	50-55	6
β-strand	67	1	6
β-strand	73-75	3	6
α-helix	79-91	13
α-helix	103-112	10
α-helix	116-121	6

Chains H, J and M: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	8
β-strand	34-39	6	8
α-helix	40-43	4
α-helix	50-54	5
β-strand	67	1	8
α-helix	72	1
β-strand	73-75	3	8
α-helix	82-91	10
α-helix	95-97	3
α-helix	103-112	10
α-helix	116-121	6

Chain K: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	11
β-strand	34-39	6	11
α-helix	40-43	4
α-helix	50-55	6
β-strand	67	1	11
α-helix	72	1
β-strand	73-75	3	11
α-helix	79-91	13
α-helix	96-97	2
α-helix	103-112	10
α-helix	116-121	6

Chain N: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	14
β-strand	34-39	6	14
α-helix	40-44	5
α-helix	50-54	5
β-strand	67	1	14
α-helix	72	1
β-strand	73-75	3	14
α-helix	82-91	10
α-helix	95-97	3
α-helix	103-112	10
α-helix	116-122	7

Chain O: 7 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	26-31	6	15
β-strand	34-39	6	15
α-helix	40-43	4
α-helix	50-55	6
β-strand	67	1	15
α-helix	72	1
β-strand	73-75	3	15
α-helix	82-91	10
α-helix	96-97	2
α-helix	103-112	10
α-helix	116-121	6

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BTB/POZ domain-containing protein KCTD16	A, B, C, D, E, F, G, H, I, J, K, L, M, N, O	protein	113	Homo sapiens	Q68DU8 (AlphaFold model)
Gamma-aminobutyric acid type B receptor subunit 2	P, Q, R	protein	15	Homo sapiens	O75899 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N, O), FASTA

>6OCP_1 BTB/POZ domain-containing protein KCTD16 (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O)
SFPEVVELNVGGQVYFTRHSTLISIPHSLLWKMFSPKRDTANDLAKDSKGRFFIDRDGFL
FRYILDYLRDRQVVLPDHFPEKGRLKREAEYFQLPDLVKLLTPDEIKQSPDEF

Sequence of entity 2 (P, Q, R), FASTA

>6OCP_2 Gamma-aminobutyric acid type B receptor subunit 2 (chains P, Q, R)
QLPILHHAYLPSIGG

Primary citation

Structural basis for auxiliary subunit KCTD16 regulation of the GABABreceptor. Zuo, H., Glaaser, I., Zhao, Y. et al. Proc Natl Acad Sci U S A (2019) 116:8370-8379. DOI 10.1073/pnas.1903024116 · PubMed

Other PDB entries of the same protein (UniProt Q68DU8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6QB7 2.23 Å, Structure of the H1 domain of human KCTD16
6OCR 2.28 Å, Crystal structure of human KCTD16 T1 domain
6I0Q 2.3 Å, Crystal structure of BTB domain of KCTD16 hexamer
5A15 2.76 Å, Crystal structure of the BTB domain of human KCTD16
6OCT 2.8 Å, Crystal structure of human KCTD16 T1 domain
6M8R 3.2 Å, Crystal structure of the KCTD16 BTB domain in complex with GABAB2 peptide

Browse structure collections

About this viewer

MolViewer shows 6OCP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.