Optimization of potent and selective ATM inhibitors suitable for a proof-of-concept study in Huntington's disease models. Determined by X-ray diffraction at 2.09 Å resolution. Released 20 Mar 2019.
Explore 6I3U in 3D Show helices and sheets RCSB PDB PDBe
6I3U contains 37 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 275-278 | 4 | |
| α-helix | 281-283 | 3 | |
| α-helix | 290-301 | 12 | |
| α-helix | 306-309 | 4 | |
| α-helix | 310-318 | 9 | |
| α-helix | 320-323 | 4 | |
| α-helix | 327-329 | 3 | |
| α-helix | 330-335 | 6 | |
| α-helix | 342-354 | 13 | |
| α-helix | 356-359 | 4 | |
| α-helix | 360-363 | 4 | |
| α-helix | 364-367 | 4 | |
| α-helix | 374-384 | 11 | |
| α-helix | 389-402 | 14 | |
| α-helix | 403-405 | 3 | |
| α-helix | 408-412 | 5 | |
| α-helix | 442-444 | 3 | |
| α-helix | 475-485 | 11 | |
| α-helix | 487-502 | 16 | |
| α-helix | 504-509 | 6 | |
| α-helix | 511-530 | 20 | |
| α-helix | 533-560 | 28 | |
| α-helix | 566-578 | 13 | |
| α-helix | 580-583 | 4 | |
| β-strand | 591-593 | 3 | 1 |
| β-strand | 596-604 | 9 | 1 |
| α-helix | 606-608 | 3 | |
| β-strand | 610-611 | 2 | 1 |
| β-strand | 619-625 | 7 | 1 |
| β-strand | 630-637 | 8 | 1 |
| α-helix | 642-660 | 19 | |
| β-strand | 672-674 | 3 | 1 |
| β-strand | 679-683 | 5 | 1 |
| β-strand | 689-690 | 2 | 2 |
| α-helix | 691-698 | 8 | |
| α-helix | 701-708 | 8 | |
| β-strand | 710 | 1 | 3 |
| α-helix | 715-717 | 3 | |
| β-strand | 718 | 1 | 3 |
| α-helix | 720-740 | 21 | |
| β-strand | 750-752 | 3 | 2 |
| β-strand | 758-760 | 3 | 2 |
| α-helix | 782-787 | 6 | |
| α-helix | 794-811 | 18 | |
| α-helix | 814-822 | 9 | |
| α-helix | 830-833 | 4 | |
| α-helix | 836-838 | 3 | |
| α-helix | 839-846 | 8 | |
| α-helix | 853-871 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phosphatidylinositol 3-kinase catalytic subunit type 3 | A | protein | 615 | Homo sapiens | Q8NEB9 (AlphaFold model) |
>6I3U_1 Phosphatidylinositol 3-kinase catalytic subunit type 3 (chains A) SMSKHHKLARSLRSGPSDHDLKPNAATRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTN QEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLR QADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKKDSQSSVSENVSNSGINSAEIDSSQI ITSPLPSVSSPPPASKTKEVPDGENLEQDLCTFLISRACKNSTLANYLYWYVIVECEDQD TQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQRESGN RKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLAKSANMPAQLFFKT EDGGKYPVLFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFLQWI QGSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDR HLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYT AFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLID ESVHALFAAVVEQIH
| ID | Name | Formula | Copies |
|---|---|---|---|
| H2E | 2-morpholin-4-yl-6-[7-[(2~{R})-1-morpholin-4-ylpropan-2-yl]oxy-9~{H}-thioxanthe… | C29 H32 N2 O5 S | 1 |
Optimization of Potent and Selective Ataxia Telangiectasia-Mutated Inhibitors Suitable for a Proof-of-Concept Study in Huntington's Disease Models. Toledo-Sherman, L., Breccia, P., Cachope, R. et al. J Med Chem (2019) 62:2988-3008. DOI 10.1021/acs.jmedchem.8b01819 · PubMed
Other PDB entries of the same protein (UniProt Q8NEB9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6I3U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.