9ORM: PDB entry 9ORM

The structure of human Vacuolar Protein Sorting 34 catalytic domain bound to RD-I-137. Determined by X-ray diffraction at 2.06 Å resolution. Released 15 Apr 2026.

Method: X-ray diffraction
Resolution: 2.06 Å
Organism: Homo sapiens
Chains: 1
Atoms: 4,552
Mol. weight: 69.08 kDa
Ligands: A1CD6
Released: 15 Apr 2026

Explore 9ORM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9ORM contains 34 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 34 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	292-301	10
α-helix	306-309	4
α-helix	310-318	9
α-helix	320-323	4
α-helix	327-329	3
α-helix	330-335	6
α-helix	342-354	13
α-helix	356-359	4
α-helix	360-366	7
α-helix	374-384	11
α-helix	389-402	14
α-helix	403-405	3
α-helix	408-413	6
α-helix	434-437	4
α-helix	475-483	9
α-helix	487-502	16
α-helix	504-509	6
α-helix	511-529	19
α-helix	533-561	29
α-helix	566-578	13
α-helix	580-583	4
β-strand	591-593	3	1
β-strand	596-604	9	1
α-helix	606-608	3
β-strand	610-611	2	1
α-helix	618	1
β-strand	619-625	7	1
β-strand	630-637	8	1
α-helix	642-660	19
β-strand	672-676	5	1
β-strand	679-683	5	1
β-strand	688-689	2	2
α-helix	690-696	7
α-helix	700-707	8
β-strand	709	1	3
α-helix	714-716	3
β-strand	717	1	3
α-helix	719-738	20
β-strand	749-751	3	2
β-strand	757-759	3	2
α-helix	781-786	6
α-helix	793-811	19
α-helix	813-821	9
α-helix	829-832	4
α-helix	835-846	12
α-helix	852-866	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphatidylinositol 3-kinase catalytic subunit type 3	A	protein	594	Homo sapiens	Q8NEB9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9ORM_1 Phosphatidylinositol 3-kinase catalytic subunit type 3 (chains A)
MGHHHHHHHHHHAATRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCV
NWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLL
QLVQALKYENFDDIKNGLEPTKKDSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPP
PASKTKEVPDGENLEQDLCTFLISRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMY
LNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALL
GDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKH
GDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTE
GSIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKL
FHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLIL
NLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALF

Ligands and cofactors

ID	Name	Formula	Copies
A1CD6	ethyl 2-[(8S)-pyrazolo[1,5-a]pyrimidin-3-yl]-1,3-benzothiazole-6-carboxylate	C16 H12 N4 O2 S	1

Water and common crystallization additives (CL, PEG, GOL) are not listed.

Primary citation

The structure of human Vacuolar Protein Sorting 34 catalytic domain bound to RD-I-137. Burtch, M., Abiodun, W., Litchfield, C. et al. To be published.

Other PDB entries of the same protein (UniProt Q8NEB9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HOG 1.26 Å, Structure of VPS34 LIR motif bound to GABARAP
7RSP 1.67 Å, Structure of the VPS34 kinase domain with compound 14
7RSV 1.78 Å, Structure of the VPS34 kinase domain with compound 5
7RSJ 1.88 Å, Structure of the VPS34 kinase domain with compound 14
4UWH 1.93 Å, Discovery of (2S)-8-((3R)-3-Methylmorpholin-4-yl)-1-(3-methyl-2-oxo-…
9NIN 2.01 Å, The structure of human Vacuolar Protein Sorting 34 catalytic domain bound to RD-I-86
8RXR 2.06 Å, Crystal structure of VPS34 in complex with inhibitor SB02024
6I3U 2.09 Å, Optimization of potent and selective ATM inhibitors suitable for a proof-of-concept…
9ZF4 2.09 Å, The structure of human Vacuolar Protein Sorting 34 catalytic domain bound to RD-II-83
9DKP 2.16 Å, The structure of human vacuolar protein sorting 34 catalytic domain bound to RD-I-53
3LS8 2.25 Å, Crystal structure of human PIK3C3 in complex with 3-[4-(4-Morpholinyl)thieno[3,2-d]pyrimi…
6HOH 2.25 Å, Structure of VPS34 LIR motif (S249E) bound to GABARAP

Browse structure collections

About this viewer

MolViewer shows 9ORM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.