6I42: Alpha-Synuclein PreNAC/Cyclophilin A-complex

Structure of the alpha-Synuclein PreNAC/Cyclophilin A-complex. Determined by X-ray diffraction at 1.38 Å resolution. Released 19 Feb 2020.

Method: X-ray diffraction
Resolution: 1.38 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,698
Mol. weight: 19.25 kDa
Released: 19 Feb 2020

Explore 6I42 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6I42 contains 5 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5-12	8	1
β-strand	15-24	10	1
α-helix	30-41	12
β-strand	52-57	6	1
β-strand	61-64	4	1
β-strand	83	1	2
β-strand	97-100	4	1
β-strand	102	1	3
β-strand	108	1	2
β-strand	112-115	4	1
α-helix	120-122	3
β-strand	128-134	7	1
α-helix	136-143	8
β-strand	156-164	9	1

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	50-53	4
β-strand	54	1	3
α-helix	56-59	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peptidyl-prolyl cis-trans isomerase A	A	protein	164	Homo sapiens	P62937 (AlphaFold model)
Alpha-synuclein	B	protein	13	Homo sapiens	P37840 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6I42_1 Peptidyl-prolyl cis-trans isomerase A (chains A)
VNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFM
CQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEW
LDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

Sequence of entity 2 (B), FASTA

>6I42_2 Alpha-synuclein (chains B)
VVHGVATVAEKTK

Primary citation

The Molecular Basis of the Interaction of Cyclophilin A with alpha-Synuclein. Favretto, F., Baker, J.D., Strohaker, T. et al. Angew Chem Int Ed Engl (2020) 59:5643-5646. DOI 10.1002/anie.201914878 · PubMed

Other PDB entries of the same protein (UniProt P62937 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9E3S 1.08 Å, Tricomplex of RMC-9945, KRAS G12N, and CypA
9BG4 1.14 Å, Tri-complex of Compound-2, KRAS G12V, and CypA
4N1M 1.15 Å, Structure of Cyclophilin A in complex with GlyPro.
5F66 1.15 Å, High-resolution isotropic multiconformer synchrotron model of CypA at 273 K
9GHY 1.15 Å, Cyclophilin A in complex with Sanglifehrin A analogue (2R,3S,7S,10S,E)-10-(3-aminopropyl)…
6GJL 1.16 Å, Cyclophilin A complexed with tri-vector ligand 10.
6GS6 1.16 Å, Cyclophilin A single mutant D66A in complex with an inhibitor.
2X25 1.2 Å, Free acetyl-CypA orthorhombic form
4YUO 1.2 Å, High-resolution multiconformer synchrotron model of CypA at 273 K
7UXM 1.2 Å, Structure of PPIA in complex with FP29092, a Helicon Polypeptide
8TBG 1.2 Å, Tricomplex of RMC-7977, HRAS WT, and CypA
9BFV 1.2 Å, Tri-complex of Compound-23, KRAS G12C, and CypA

Browse structure collections

About this viewer

MolViewer shows 6I42 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.