Crystal structure of human ERRg LBD in complex with HPTE. Determined by X-ray diffraction at 1.65 Å resolution. Released 3 Jul 2019.
Explore 6I62 in 3D Show helices and sheets RCSB PDB PDBe
6I62 contains 13 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 236-243 | 8 | |
| α-helix | 245-248 | 4 | |
| α-helix | 258-259 | 2 | |
| α-helix | 261-283 | 23 | |
| α-helix | 289-291 | 3 | |
| α-helix | 294-316 | 23 | |
| β-strand | 324-327 | 4 | 1 |
| β-strand | 330-332 | 3 | 1 |
| α-helix | 334-339 | 6 | |
| α-helix | 343-358 | 16 | |
| α-helix | 363-375 | 13 | |
| α-helix | 385-406 | 22 | |
| α-helix | 413-418 | 6 | |
| α-helix | 421-441 | 21 | |
| α-helix | 448-456 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Estrogen-related receptor gamma | A | protein | 237 | Homo sapiens | P62508 (AlphaFold model) |
>6I62_1 Estrogen-related receptor gamma (chains A) LNPQLVQPAKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIG WAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAG LLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQD YEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
| ID | Name | Formula | Copies |
|---|---|---|---|
| 27N | 4,4'-(2,2,2-trichloroethane-1,1-diyl)diphenol | C14 H11 Cl3 O2 | 1 |
Insights into the activation mechanism of human estrogen-related receptor gamma by environmental endocrine disruptors. Thouennon, E., Delfosse, V., Bailly, R. et al. Cell Mol Life Sci (2019) 76:4769-4781. DOI 10.1007/s00018-019-03129-x · PubMed
Other PDB entries of the same protein (UniProt P62508 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6I62 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.