Crystal structure of PTK2 in complex with BI-4464. Determined by X-ray diffraction at 1.99 Å resolution. Released 20 Feb 2019.
Explore 6I8Z in 3D Show helices and sheets RCSB PDB PDBe
6I8Z contains 19 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 416 | 1 | 1 |
| α-helix | 419-421 | 3 | |
| β-strand | 422-430 | 9 | 1 |
| β-strand | 435-442 | 8 | 1 |
| β-strand | 448-455 | 8 | 1 |
| α-helix | 462-476 | 15 | |
| β-strand | 483 | 1 | 2 |
| α-helix | 484-485 | 2 | |
| β-strand | 486-490 | 5 | 1 |
| α-helix | 495 | 1 | |
| β-strand | 496-500 | 5 | 1 |
| β-strand | 506 | 1 | 2 |
| α-helix | 507-513 | 7 | |
| α-helix | 520-539 | 20 | |
| α-helix | 549-551 | 3 | |
| β-strand | 552-556 | 5 | 2 |
| β-strand | 559-562 | 4 | 2 |
| α-helix | 565-568 | 4 | |
| α-helix | 586-588 | 3 | |
| α-helix | 591-596 | 6 | |
| α-helix | 601-616 | 16 | |
| α-helix | 620-621 | 2 | |
| α-helix | 628-630 | 3 | |
| α-helix | 631-636 | 6 | |
| α-helix | 641-644 | 4 | |
| α-helix | 649-658 | 10 | |
| α-helix | 663-665 | 3 | |
| α-helix | 667-668 | 2 | |
| α-helix | 669-687 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Focal adhesion kinase 1 | A | protein | 281 | Homo sapiens | Q05397 (AlphaFold model) |
>6I8Z_1 Focal adhesion kinase 1 (chains A) GSSTRDYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKF LQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAY QLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKW MAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCP PTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQQEE
| ID | Name | Formula | Copies |
|---|---|---|---|
| H82 | 3-methoxy-~{N}-(1-methylpiperidin-1-ium-4-yl)-4-[[4-[(3-oxidanylidene-1,2-dihyd… | C28 H29 F3 N5 O4 | 1 |
Highly Selective PTK2 Proteolysis Targeting Chimeras to Probe Focal Adhesion Kinase Scaffolding Functions. Popow, J., Arnhof, H., Bader, G. et al. J Med Chem (2019) 62:2508-2520. DOI 10.1021/acs.jmedchem.8b01826 · PubMed
Other PDB entries of the same protein (UniProt Q05397 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6I8Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.