6I9J: Transforming growth factor beta-2 proprotein

Human transforming growth factor beta2 in a tetragonal crystal form. Determined by X-ray diffraction at 2.0 Å resolution. Released 3 Jul 2019.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 913
Mol. weight: 12.73 kDa
Released: 3 Jul 2019

Explore 6I9J in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6I9J contains 4 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	304-305	2	1
α-helix	306-309	4
β-strand	316	1	2
β-strand	318-320	3	3
β-strand	323-325	3	4
α-helix	326-330	5
β-strand	337	1	5
β-strand	340-342	3	4
β-strand	345-347	3	3
β-strand	349	1	2
α-helix	352-354	3
α-helix	359-370	12
β-strand	380-382	3	1
β-strand	385-394	10	5
β-strand	397-408	12	5
β-strand	410-413	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transforming growth factor beta-2 proprotein	A	protein	112	Homo sapiens	P61812 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6I9J_1 Transforming growth factor beta-2 proprotein (chains A)
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSR
VLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Primary citation

Recombinant production, purification, crystallization, and structure analysis of human transforming growth factor beta 2 in a new conformation. Del Amo-Maestro, L., Marino-Puertas, L., Goulas, T. et al. Sci Rep (2019) 9:8660-8660. DOI 10.1038/s41598-019-44943-4 · PubMed

Other PDB entries of the same protein (UniProt P61812 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2TGI 1.8 Å, Crystal structure of transforming growth factor-BETA2: an unusual fold for the superfamily
5TX4 1.88 Å, Derivative of mouse TGF-beta2, with a deletion of residues 52-71 and K25R, R26K, L51R,…
6XM2 1.91 Å, The structure of the 4A11.v7 antibody in complex with human TGFb2
8DC0 1.93 Å, Rat Betaglycan Zona Pellucida Domain (ZPC) in complex with mini monomer TGFb2…
1TFG 1.95 Å, An unusual feature revealed by the crystal structure at 2.2 Å resolution of human…
8FXV 2.2 Å, Crystal structure of human proTGF-beta2 in complex with Nb18
4KXZ 2.83 Å, crystal structure of tgfb2 in complex with GC2008.
5TY4 2.9 Å, MicroED structure of a complex between monomeric TGF-b and its receptor, TbRII, at 2.9 A…
7RCO 2.9 Å, Crystal structure of human TGF-beta-2 bound to 4A11.V2 Fab
8FXS 3.15 Å, Crystal structure of human pro-TGF-beta2 in complex with Nb9

Browse structure collections

About this viewer

MolViewer shows 6I9J directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.