MicroED structure of a complex between monomeric TGF-b and its receptor, TbRII, at 2.9 A resolution. Determined by electron crystallography at 2.9 Å resolution. Released 26 Apr 2017.
Explore 5TY4 in 3D Show helices and sheets RCSB PDB PDBe
5TY4 contains 1 α-helix and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 55-58 | 4 | 1 |
| β-strand | 66-68 | 3 | 2 |
| β-strand | 75 | 1 | 3 |
| β-strand | 83-90 | 8 | 1 |
| β-strand | 95-102 | 8 | 1 |
| β-strand | 108 | 1 | 4 |
| β-strand | 111 | 1 | 4 |
| β-strand | 122 | 1 | 2 |
| β-strand | 124-125 | 2 | 1 |
| β-strand | 132 | 1 | 1 |
| β-strand | 134-138 | 5 | 1 |
| α-helix | 143-145 | 3 | |
| β-strand | 146-148 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 322 | 1 | 5 |
| β-strand | 335 | 1 | 3 |
| β-strand | 339 | 1 | 5 |
| β-strand | 379-380 | 2 | 6 |
| β-strand | 383-391 | 9 | 3 |
| β-strand | 396-406 | 11 | 3 |
| β-strand | 409-410 | 2 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| TGF-beta receptor type-2 | A | protein | 103 | Homo sapiens | P37173 (AlphaFold model) |
| mmTGF-b2-7m | B | protein | 97 | Homo sapiens | P61812 (AlphaFold model) |
>5TY4_1 TGF-beta receptor type-2 (chains A) FPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKL PYHDFILEDAASPTCIMKEKKKPGETFFMCSCSSDECNDNIIF
>5TY4_2 mmTGF-b2-7m (chains B) CCLRPLYIDFRKDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASA SPCCVSQDLEPLTIVYYVGRKPKVEQLSNMIVKSCKC
Atomic-resolution structures from fragmented protein crystals with the cryoEM method MicroED. de la Cruz, M.J., Hattne, J., Shi, D. et al. Nat Methods (2017) 14:399-402. DOI 10.1038/nmeth.4178 · PubMed
Other PDB entries of the same protein (UniProt P37173 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5TY4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.