6IGO: Myelin protein zero-like protein 1

Crystal structure of myelin protein zero-like protein 1 (MPZL1). Determined by X-ray diffraction at 2.75 Å resolution. Released 28 Nov 2018.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: Homo sapiens
Chains: 6
Atoms: 5,666
Mol. weight: 91.32 kDa
Released: 28 Nov 2018

Explore 6IGO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6IGO contains 22 α-helices and 87 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	39-41	3	5
β-strand	45-49	5	6
β-strand	54-56	3	7
β-strand	59-61	3	5
α-helix	65-66	2
β-strand	71-78	8	6
β-strand	85-91	7	6
β-strand	94-97	4	6
α-helix	101-103	3
β-strand	107-109	3	7
β-strand	112	1	5
β-strand	117	1	5
β-strand	120-122	3	7
α-helix	127-129	3
β-strand	131-138	8	6
β-strand	139	1	8
β-strand	142	1	8
α-helix	146-147	2
β-strand	148-155	8	6

Chain B: 5 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	40-41	2	9
β-strand	45-48	4	10
β-strand	52-56	5	11
β-strand	59-60	2	9
α-helix	65-66	2
β-strand	71-78	8	10
β-strand	85-91	7	10
β-strand	94-97	4	10
α-helix	101-103	3
β-strand	107-109	3	11
α-helix	113-115	3
β-strand	117	1	9
β-strand	120-125	6	11
α-helix	127-129	3
β-strand	131-138	8	10
β-strand	139	1	12
β-strand	142	1	12
α-helix	146-147	2
β-strand	148-154	7	10

Chain C: 4 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	38-41	4	1
β-strand	45-49	5	2
β-strand	54-56	3	3
β-strand	59-62	4	1
α-helix	65-66	2
β-strand	71-78	8	2
β-strand	85-91	7	2
β-strand	94-97	4	2
α-helix	101-103	3
β-strand	107-109	3	3
β-strand	117	1	1
β-strand	120-122	3	3
α-helix	127-129	3
β-strand	131-138	8	2
β-strand	139	1	4
β-strand	142	1	4
α-helix	146-147	2
β-strand	148-155	8	2

Chain D: 2 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	39-41	3	13
β-strand	45-49	5	14
β-strand	54-56	3	15
β-strand	59-61	3	13
β-strand	71-78	8	14
β-strand	85-91	7	14
β-strand	94-97	4	14
β-strand	107-109	3	15
β-strand	112	1	13
β-strand	117	1	13
β-strand	120-122	3	15
α-helix	127-129	3
β-strand	131-138	8	14
β-strand	139	1	16
β-strand	142	1	16
α-helix	146-147	2
β-strand	148-155	8	14

Chain E: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	40-41	2	17
β-strand	45-49	5	18
β-strand	54-56	3	19
β-strand	59-60	2	17
α-helix	65-66	2
β-strand	71-78	8	18
β-strand	85-91	7	18
β-strand	94-97	4	18
β-strand	107-109	3	19
β-strand	112	1	17
α-helix	113-115	3
β-strand	117	1	17
β-strand	120-122	3	19
α-helix	127-129	3
β-strand	131-138	8	18
β-strand	139	1	20
β-strand	142	1	20
α-helix	146-147	2
β-strand	148-155	8	18

Chain F: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	40-41	2	21
β-strand	45-49	5	22
β-strand	54-56	3	23
β-strand	59-60	2	21
α-helix	65-66	2
β-strand	71-78	8	22
β-strand	85-91	7	22
β-strand	94-97	4	22
β-strand	107-109	3	23
β-strand	117	1	21
β-strand	120-122	3	23
α-helix	127-129	3
β-strand	131-138	8	22
β-strand	139	1	24
β-strand	142	1	24
α-helix	146-147	2
β-strand	148-155	8	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myelin protein zero-like protein 1	A, B, C, D, E, F	protein	135	Homo sapiens	O95297 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>6IGO_1 Myelin protein zero-like protein 1 (chains A, B, C, D, E, F)
SALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQV
YLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVV
EKENLPVLEHHHHHH

Primary citation

Structural and biochemical studies of the extracellular domain of Myelin protein zero-like protein 1. Yu, T., Liang, L., Zhao, X. et al. Biochem Biophys Res Commun (2018) 506:883-890. DOI 10.1016/j.bbrc.2018.10.161 · PubMed

Other PDB entries of the same protein (UniProt O95297 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9MQ5 1.7 Å, Crystal structure SHP2 tandem SH2 domains in complex with PZR doubly tyrosine…
6IGW 1.98 Å, MPZL1 mutant - S86G, V145G, Q146K,P147T,G148S
6IGT 2.4 Å, MPZL1 mutant - V145G, Q146K, P147T and G148S

Browse structure collections

About this viewer

MolViewer shows 6IGO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.