MPZL1 mutant - S86G, V145G, Q146K,P147T,G148S. Determined by X-ray diffraction at 1.98 Å resolution. Released 28 Nov 2018.
Explore 6IGW in 3D Show helices and sheets RCSB PDB PDBe
6IGW contains 3 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 39-41 | 3 | 1 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 54-56 | 3 | 3 |
| β-strand | 59-61 | 3 | 1 |
| β-strand | 71-78 | 8 | 2 |
| β-strand | 85-91 | 7 | 2 |
| β-strand | 94-97 | 4 | 2 |
| α-helix | 101-103 | 3 | |
| β-strand | 107-109 | 3 | 3 |
| β-strand | 112 | 1 | 1 |
| α-helix | 113-115 | 3 | |
| β-strand | 117 | 1 | 1 |
| β-strand | 120-122 | 3 | 3 |
| α-helix | 127-129 | 3 | |
| β-strand | 131-138 | 8 | 2 |
| β-strand | 146-155 | 10 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Myelin protein zero-like protein 1 | A | protein | 135 | Homo sapiens | O95297 (AlphaFold model) |
>6IGW_1 Myelin protein zero-like protein 1 (chains A) SALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVGFFHYSQGQV YLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVGKTSHIRLYVV EKENLPVLEHHHHHH
Structural and biochemical studies of the extracellular domain of Myelin protein zero-like protein 1. Yu, T., Liang, L., Zhao, X. et al. Biochem Biophys Res Commun (2018) 506:883-890. DOI 10.1016/j.bbrc.2018.10.161 · PubMed
Other PDB entries of the same protein (UniProt O95297 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6IGW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.