6IPY: His-tagged Fyn SH3 domain R96I mutant
His-tagged Fyn SH3 domain R96I mutant. Determined by X-ray diffraction at 1.34 Å resolution. Released 28 Nov 2018.
- Method
- X-ray diffraction
- Resolution
- 1.34 Å
- Organism
- Homo sapiens
- Chains
- 1
- Atoms
- 584
- Mol. weight
- 9.28 kDa
- Released
- 28 Nov 2018
Explore 6IPY in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6IPY contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 2 helices, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 87-89 | 3 | 1 |
| β-strand | 93 | 1 | 2 |
| β-strand | 100 | 1 | 1 |
| β-strand | 103 | 1 | 2 |
| β-strand | 108-113 | 6 | 1 |
| β-strand | 119-124 | 6 | 1 |
| β-strand | 130-134 | 5 | 1 |
| α-helix | 135-137 | 3 | |
| β-strand | 138-140 | 3 | 1 |
| α-helix | 142-145 | 4 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Tyrosine-protein kinase Fyn | A | protein | 81 | Homo sapiens | P06241 (AlphaFold model) |
Sequence of entity 1 (A), FASTA
>6IPY_1 Tyrosine-protein kinase Fyn (chains A)
NFVLEGDIHMTGVTLFVALYDYEAITEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETG
YIPSNYVAPVDSILEHHHHHH
Primary citation
Synergy and allostery in ligand binding by HIV-1 Nef. Aldehaiman, A., Momin, A.A., Restouin, A. et al. Biochem J (2021) 478:1525-1545. DOI 10.1042/BCJ20201002 · PubMed
Other PDB entries of the same protein (UniProt P06241 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7A2P 0.9 Å, Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant at pH 5.0…
- 7A2X 0.92 Å, Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant in complex…
- 7A2O 0.94 Å, Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant at pH 4.5
- 7A2Q 0.94 Å, Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant at pH 3.0…
- 7A2Y 0.97 Å, Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant in complex…
- 7A2W 0.99 Å, Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant in complex…
- 8KDX 1.01 Å, Tau-S214 Phosphorylation Inhibits Fyn Kinase Interaction and Increases the Decay Time of…
- 7A2S 1.02 Å, Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant at pH 5.0
- 7A2R 1.05 Å, Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant at pH 6.0
- 7A2Z 1.14 Å, Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant in complex…
- 7A2T 1.22 Å, Crystal structure of the Fyn SH3 domain L112V-S114N-S115T-E121L-R123H mutant at pH 4.0
- 4U1P 1.4 Å, Human Fyn-SH2 domain in complex with a synthetic high-affinity phospho-peptide
Browse structure collections
About this viewer
MolViewer shows 6IPY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.