6IRB: PDB entry 6IRB

C-terminal coiled coil domain of Drosophila phospholipase C beta NORPA, selenomethionine. Determined by X-ray diffraction at 2.66 Å resolution. Released 2 Jan 2019.

Method: X-ray diffraction
Resolution: 2.66 Å
Organism: Drosophila melanogaster
Chains: 2
Atoms: 3,361
Mol. weight: 50.18 kDa
Released: 2 Jan 2019

Explore 6IRB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6IRB contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	24-26	3
α-helix	29-31	3
α-helix	33-37	5
α-helix	40-172	133
α-helix	180-233	54

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	24-26	3
α-helix	29-31	3
α-helix	33-38	6
α-helix	40-172	133
α-helix	183-233	51

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase	A, B	protein	211	Drosophila melanogaster	P13217 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6IRB_1 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase (chains A, B)
EPPLVFEPVTLESLRQEKGFQEVGKKQIKELDTLREKHAKERTSVQKTQNAAIDKLIKGK
SKDDIRNDANIKNSINDQTKQWTDMIARHRKEEWDMLRQHVQDSQDAMKALMLTVQAAQI
KQLEDRHARDIKDLNAKQAKMSADTAKEVQNDTLKTKNEKDRRLREKRQNNVKRFMEEKK
QIGVKQGRAMEKLKLAHSKQIEEFSTDVQKL

Primary citation

An unexpected INAD PDZ tandem-mediated plc beta binding in Drosophila photo receptors. Ye, F., Huang, Y., Li, J. et al. Elife (2018) 7. DOI 10.7554/eLife.41848 · PubMed

Other PDB entries of the same protein (UniProt P13217 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6IRE 3.25 Å, Complex structure of INAD PDZ45 and NORPA CC-PBM
6IRC 3.54 Å, C-terminal domain of Drosophila phospholipase b NORPA, methylated

Browse structure collections

About this viewer

MolViewer shows 6IRB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.