6IRC: PDB entry 6IRC

C-terminal domain of Drosophila phospholipase b NORPA, methylated. Determined by X-ray diffraction at 3.54 Å resolution. Released 2 Jan 2019.

Method: X-ray diffraction
Resolution: 3.54 Å
Organism: Drosophila melanogaster
Chains: 1
Atoms: 1,521
Mol. weight: 27.53 kDa
Released: 2 Jan 2019

Explore 6IRC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6IRC contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	873-878	6
α-helix	880-919	40
α-helix	931-1013	83
α-helix	1020-1077	58

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase	A	protein	233	Drosophila melanogaster	P13217 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6IRC_1 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase (chains A)
EPPLVFEPVTLESLRQEKGFQKVGKKQIKELDTLRKKHAKERTSVQKTQNAAIDKLIKGK
SKDDIRNDANIKNSINDQTKQWTDMIARHRKEEWDMLRQHVQDSQDAMKALMLTVQAAQI
KQLEDRHARDIKDLNAKQAKMSADTAKEVQNDKTLKTKNEKDRRLREKRQNNVKRFMEEK
KQIGVKQGRAMEKLKLAHSKQIEEFSTDVQKLMDMYKIEEEAYKTQGKTEFYA

Primary citation

An unexpected INAD PDZ tandem-mediated plc beta binding in Drosophila photo receptors. Ye, F., Huang, Y., Li, J. et al. Elife (2018) 7. DOI 10.7554/eLife.41848 · PubMed

Other PDB entries of the same protein (UniProt P13217 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6IRB 2.66 Å, C-terminal coiled coil domain of Drosophila phospholipase C beta NORPA, selenomethionine
6IRE 3.25 Å, Complex structure of INAD PDZ45 and NORPA CC-PBM

Browse structure collections

About this viewer

MolViewer shows 6IRC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.