6IRR: DISC1/ATF4 complex

Solution structure of DISC1/ATF4 complex. Determined by solution NMR. Released 25 Sept 2019.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 1,022
Mol. weight: 14.57 kDa
Released: 25 Sept 2019

Explore 6IRR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6IRR contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	14-38	25
α-helix	42-65	24
α-helix	74-76	3
α-helix	101-126	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disrupted in schizophrenia 1 homolog,Cyclic AMP-dependent transcription factor ATF-4	A	protein	133	Mus musculus	Q06507 (AlphaFold model), Q811T9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6IRR_1 Disrupted in schizophrenia 1 homolog,Cyclic AMP-dependent transcription factor ATF-4 (chains A)
GPWKEDSHIVSAEVGEKCEAIGVKLLHLEDQLLGAMYSHDEALFQSLQGELQTVKETLQA
MILQLQPTKEAGEASASYPTAGAQETEALVPRGSGFGKNEALKEKADSLAKEIQYLKDLI
EEVRKARGKKRVP

Primary citation

Structural interaction between DISC1 and ATF4 underlying transcriptional and synaptic dysregulation in an iPSC model of mental disorders. Wang, X., Ye, F., Wen, Z. et al. Mol Psychiatry (2019). DOI 10.1038/s41380-019-0485-2 · PubMed

Browse structure collections

About this viewer

MolViewer shows 6IRR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.