6IRT: Human LAT1-4F2hc complex

human LAT1-4F2hc complex bound with BCH. Determined by electron microscopy at 3.5 Å resolution. Released 27 Mar 2019.

Method: Electron microscopy
Resolution: 3.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,348
Mol. weight: 130.67 kDa
Ligands: 3PH, AUU
Released: 27 Mar 2019

Explore 6IRT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6IRT contains 50 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	169-174	6
α-helix	181-184	4
α-helix	186-207	22
α-helix	212-214	3
α-helix	219-221	3
β-strand	224	1	1
β-strand	225-228	4	2
α-helix	231-234	4
α-helix	242-245	4
α-helix	249-255	7
β-strand	257	1	1
β-strand	259-262	4	2
β-strand	266-268	3	3
β-strand	276-281	6	3
α-helix	282	1
α-helix	288-300	13
β-strand	304-308	5	2
α-helix	325-341	17
β-strand	345-348	4	2
α-helix	351-353	3
α-helix	357-369	13
β-strand	376-379	4	2
α-helix	386-392	7
β-strand	400-401	2	2
α-helix	413-427	15
β-strand	432	1	4
α-helix	451-460	10
β-strand	463	1	4
β-strand	466-468	3	2
α-helix	494-496	3
α-helix	510-513	4
α-helix	520-531	12
α-helix	535-539	5
β-strand	541-545	5	5
β-strand	551-557	7	5
β-strand	563-569	7	5
β-strand	576	1	6
β-strand	593-594	2	7
β-strand	595-599	5	5
β-strand	610-611	2	7
β-strand	616	1	6
β-strand	623-627	5	5

Chain B: 30 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	53-62	10
α-helix	67-69	3
α-helix	71-73	3
α-helix	82-109	28
α-helix	118-123	6
α-helix	127-135	9
α-helix	136-140	5
α-helix	141-157	17
α-helix	165-167	3
α-helix	168-186	19
α-helix	190-198	9
α-helix	202-221	20
α-helix	231-234	4
α-helix	244-250	7
α-helix	261-264	4
α-helix	265-268	4
α-helix	274-299	26
α-helix	304-307	4
α-helix	311-319	9
α-helix	327-332	6
α-helix	335-338	4
α-helix	340-342	3
α-helix	345-354	10
β-strand	366	1	8
α-helix	374-385	12
α-helix	386-389	4
α-helix	394-420	27
α-helix	435-452	18
α-helix	455-465	11
α-helix	470-475	6
α-helix	485-500	16
β-strand	503	1	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
4F2 cell-surface antigen heavy chain	A	protein	647	Homo sapiens	P08195 (AlphaFold model)
Large neutral amino acids transporter small subunit 1	B	protein	527	Homo sapiens	Q01650 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6IRT_1 4F2 cell-surface antigen heavy chain (chains A)
MAHHHHHHHHHHSGRELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSETGSDCVTQ
AGLQLLASSDPPALASKNAEVTVETGFHHVSQADIEFLTSIDPTASASGSAGITGTMSQD
TEVDMKEVELNELEPEKQPMNAASGAAMSLAGAEKNGLVKIKVAEDEAEAAAAAKFTGLS
KEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALY
RIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFG
SKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGF
QVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYL
SDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPV
FSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRR
LSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPA
SASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAALE

Sequence of entity 2 (B), FASTA

>6IRT_2 Large neutral amino acids transporter small subunit 1 (chains B)
MADYKDDDDKSGPDEVDASGRAGAGPKRRALAAPAAEEKEEAREKMLAAKSADGSEPAGE
GEGVTLQRNITLLNGVAIIVGTIIGSGIFVTPTGVLKEAGSPGLALVVWAACGVFSIVGA
LCYAELGTTISKSGGDYAYMLEVYGSLPAFLKLWIELLIIRPSSQYIVALVFATYLLKPL
FPTCPVPEEAAKLVACLCVLLLTAVNCYSVKAATRVQDAFAAAKLLALALIILLGFVQIG
KGDVSNLDPNFSFEGTKLDVGNIVLALYSGLFAYGGWNYLNFVTEEMINPYRNLPLAIII
SLPIVTLVYVLTNLAYFTTLSTEQMLSSEAVAVDFGNYHLGVMSWIIPVFVGLSCFGSVN
GSLFTSSRLFFVGSREGHLPSILSMIHPQLLTPVPSLVFTCVMTLLYAFSKDIFSVINFF
SFFNWLCVALAIIGMIWLRHRKPELERPIKVNLALPVFFILACLFLIAVSFWKTPVECGI
GFTIILSGLPVYFFGVWWKNKPKWLLQGIFSTTVLCQKLMQVVPQET

Ligands and cofactors

ID	Name	Formula	Copies
3PH	1,2-diacyl-glycerol-3-sn-phosphate	C39 H77 O8 P	2
AUU	(1S,2S,4R)-2-aminobicyclo[2.2.1]heptane-2-carboxylic acid	C8 H13 N O2	1

Primary citation

Structure of the human LAT1-4F2hc heteromeric amino acid transporter complex. Yan, R., Zhao, X., Lei, J. et al. Nature (2019) 568:127-130. DOI 10.1038/s41586-019-1011-z · PubMed

Other PDB entries of the same protein (UniProt P08195 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S8V 1.8 Å, Structure of the high affinity Anticalin P3D11 in complex with the human CD98 heavy…
2DH2 2.1 Å, Crystal Structure of human ED-4F2hc
8G0M 2.25 Å, Structure of complex between TV6.6 and CD98hc ECD
9KJU 2.7 Å, Local refinement of the y+LAT1-4F2hc bound with Arg
2DH3 2.8 Å, Crystal Structure of human ED-4F2hc
7DF1 2.81 Å, Crystal structure of human CD98 heavy chain extracellular domain in complex with S1-F4…
7CMI 2.9 Å, The LAT2-4F2hc complex in complex with leucine
7DSK 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-075
7DSL 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-078
8YLP 2.9 Å, Overall structure of the y+LAT1-4F2hc bound with Arg
7DSN 3.1 Å, Overall structure of the LAT1-4F2hc bound with JX-119
8X0W 3.1 Å, Overall structure of the LAT1-4F2hc bound with Leu

Browse structure collections

About this viewer

MolViewer shows 6IRT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.