High resolution structure of Dvl2-DIX Y27W/C80S mutant. Determined by X-ray diffraction at 1.64 Å resolution. Released 20 Feb 2019.
Explore 6IW3 in 3D Show helices and sheets RCSB PDB PDBe
6IW3 contains 2 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 14-20 | 7 | 1 |
| β-strand | 27-31 | 5 | 1 |
| β-strand | 39 | 1 | 2 |
| α-helix | 40-44 | 5 | |
| β-strand | 54-61 | 8 | 1 |
| β-strand | 65-70 | 6 | 1 |
| β-strand | 77 | 1 | 2 |
| α-helix | 78-79 | 2 | |
| β-strand | 81 | 1 | 1 |
| β-strand | 84-90 | 7 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Segment polarity protein dishevelled homolog DVL-2 | A | protein | 82 | Homo sapiens | O14641 (AlphaFold model) |
>6IW3_1 Segment polarity protein dishevelled homolog DVL-2 (chains A) GETKVIYHLDEEETPWLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEI SDDNARLPSFNGRVVSWLVSSD
High-resolution structure of a Y27W mutant of the Dishevelled2 DIX domain. Yamanishi, K., Sin, Y., Terawaki, S.I. et al. Acta Crystallogr F Struct Biol Commun (2019) 75:116-122. DOI 10.1107/S2053230X18018290 · PubMed
Other PDB entries of the same protein (UniProt O14641 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6IW3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.