6IXE: SeMet apo SH3BP5

Crystal structure of SeMet apo SH3BP5 (I41). Determined by X-ray diffraction at 3.35 Å resolution. Released 20 Mar 2019.

Method: X-ray diffraction
Resolution: 3.35 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,745
Mol. weight: 26.81 kDa
Ligands: SIN
Released: 20 Mar 2019

Explore 6IXE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6IXE contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	42-90	49
α-helix	92-142	51
α-helix	152-199	48
α-helix	205-259	55

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SH3 domain-binding protein 5	A	protein	228	Homo sapiens	O60239 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6IXE_1 SH3 domain-binding protein 5 (chains A)
SHVDPRIQGELEKLNQSTDDINRRETELEDARQKFRSVLVEATVKLDELVKKIGKAVEDS
KPYWEARRVARQAQLEAQKATQDFQRATEVLRAAKETISLAEQRLLEDDKRQFDSAWQEM
LNHATQRVAEAEQTKTRSELVHKETAARYNAAMGRMRQLEKKLKRAINKSKPYFELKAKY
YVQLEQLKKTVDDLQAKLTLAKGEYKMALKNLEMISDEIHEAAASSAM

Ligands and cofactors

ID	Name	Formula	Copies
SIN	Succinic acid	C4 H6 O4	1

Primary citation

Structural basis of guanine nucleotide exchange for Rab11 by SH3BP5. Goto-Ito, S., Morooka, N., Yamagata, A. et al. Life Sci Alliance (2019) 2. DOI 10.26508/lsa.201900297 · PubMed

Other PDB entries of the same protein (UniProt O60239 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4H3B 2.08 Å, Crystal Structure of JNK3 in Complex with SAB Peptide
6DJL 3.1 Å, Crystal structure of the Rab11 GEF SH3BP5 bound to nucleotide free Rab11A
6IXF 3.6 Å, Crystal structure of SeMet apo SH3BP5 (P41)
6IXV 3.8 Å, Crystal structure of SH3BP5-Rab11a
6IXG 3.8 Å, Crystal structure of native apo SH3BP5 (P41)

Browse structure collections

About this viewer

MolViewer shows 6IXE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.