6IYY: Human WIPI3,loop deletion mutant

Crystal structure of human WIPI3,loop deletion mutant. Determined by X-ray diffraction at 1.8 Å resolution. Released 13 Mar 2019.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,659
Mol. weight: 35.64 kDa
Released: 13 Mar 2019

Explore 6IYY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6IYY contains 3 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	10-15	6	1
β-strand	21-26	6	1
β-strand	29-35	7	1
β-strand	38-44	7	1
β-strand	51-57	7	2
α-helix	58-60	3
β-strand	62-67	6	2
β-strand	72-77	6	2
β-strand	82-88	7	2
β-strand	95-99	5	3
β-strand	102-106	5	3
β-strand	110-115	6	3
β-strand	122-127	6	3
β-strand	137-138	2	4
β-strand	146-150	5	4
β-strand	156-161	6	4
α-helix	168-169	2
β-strand	170-173	4	4
β-strand	179-184	6	5
β-strand	190-195	6	5
β-strand	200-205	6	5
β-strand	211-216	6	5
β-strand	224-229	6	6
β-strand	235-240	6	6
β-strand	244-249	6	6
β-strand	257	1	5
β-strand	260-263	4	6
β-strand	270-274	5	7
β-strand	280-285	6	7
β-strand	289-294	6	7
β-strand	302-308	7	7
α-helix	309-311	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
WD repeat domain phosphoinositide-interacting protein 3	A	protein	317	Homo sapiens	Q5MNZ6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6IYY_1 WD repeat domain phosphoinositide-interacting protein 3 (chains A)
GPGSPHGNGLLYAGFNQDHGCFACGMENGFRVYNTDPLKEKEKQEFLEGGVGHVEMLFRC
NYLALVGGGKKKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVVVLDSMIKVFTFTHNP
HQLHVFETCYNPKGLCVLCPNSNNSLLAFPGTHTGHVQLVDLASTEKPPVDIPAHEGVLS
CIALNLQGTRIATASEKGTLIRIFDTSSGHLIQELRRGSQAANIYCINFNQDASLICVSS
DHGTVHIFAAEDPKSKWSFSKFQVPSGSPCICAFGTEPNAVIAICADGSYYKFLFNPKGE
CIRDVYAQFLEMTDDKL

Primary citation

Structural Conservation of the Two Phosphoinositide-Binding Sites in WIPI Proteins. Liang, R., Ren, J., Zhang, Y. et al. J Mol Biol (2019) 431:1494-1505. DOI 10.1016/j.jmb.2019.02.019 · PubMed

Other PDB entries of the same protein (UniProt Q5MNZ6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KLR 2.21 Å, Crystal structure of human WIPI3 in complex with the WIR-peptide from ATG2A
8ZQG 2.77 Å, Crystal structure of WIPI3 in complex with ATG16L1
9CE3 2.9 Å, Structure of the TSC:WIPI3 lysosomal recruitment complex
9C9I 3.18 Å, Structure of the TSC1:WIPI3 complex

Browse structure collections

About this viewer

MolViewer shows 6IYY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.