6J0G: Intracellular B30.2 domain of BTN3A3 mutant

Crystal structure of intracellular B30.2 domain of BTN3A3 mutant in complex with HMBPP. Determined by X-ray diffraction at 1.6 Å resolution. Released 3 Apr 2019.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 4
Atoms: 7,091
Mol. weight: 102.14 kDa
Ligands: H6P
Released: 3 Apr 2019

Explore 6J0G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6J0G contains 26 α-helices and 66 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	297-306	10
β-strand	308-309	2	1
α-helix	310	1
β-strand	314	1	2
β-strand	323-325	3	1
β-strand	331-334	4	1
β-strand	353-355	3	3
β-strand	356	1	2
β-strand	360	1	3
β-strand	364-370	7	1
β-strand	377-383	7	3
α-helix	397-399	3
β-strand	401-407	7	3
β-strand	411-414	4	3
α-helix	419	1
β-strand	420-421	2	3
β-strand	430-436	7	1
β-strand	441-446	6	1
β-strand	452-455	4	1
α-helix	456	1
α-helix	458-459	2
β-strand	465-470	6	3
α-helix	477-478	2
β-strand	479-481	3	1
α-helix	482-484	3

Chain B: 5 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	298-306	9
β-strand	308-309	2	4
α-helix	310	1
β-strand	314-315	2	5
β-strand	323-325	3	4
β-strand	331-334	4	4
β-strand	353-356	4	5
β-strand	360	1	5
β-strand	364-370	7	4
β-strand	377-383	7	5
α-helix	397-399	3
β-strand	401-407	7	5
β-strand	411-414	4	5
α-helix	419	1
β-strand	420-422	3	5
β-strand	430-436	7	4
β-strand	441-446	6	4
β-strand	452-455	4	4
β-strand	465-470	6	5
β-strand	479-481	3	4
α-helix	482-483	2

Chain C: 4 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	298-306	9
β-strand	308-309	2	6
β-strand	314-315	2	7
β-strand	323-325	3	6
β-strand	331-334	4	6
β-strand	353-356	4	7
β-strand	360	1	7
β-strand	364-370	7	6
β-strand	377-383	7	7
α-helix	397-399	3
β-strand	401-407	7	7
β-strand	411-414	4	7
β-strand	420-421	2	7
β-strand	430-436	7	6
β-strand	441-446	6	6
β-strand	452-455	4	6
β-strand	465-470	6	7
α-helix	477-478	2
β-strand	479-481	3	6
α-helix	482-483	2

Chain D: 9 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	298-306	9
β-strand	308-309	2	8
α-helix	310	1
β-strand	314	1	9
β-strand	323-325	3	8
β-strand	331-334	4	8
β-strand	353-355	3	10
β-strand	356	1	9
β-strand	360	1	10
β-strand	364-370	7	8
β-strand	377-383	7	10
α-helix	397-399	3
β-strand	401-407	7	10
β-strand	411-414	4	10
α-helix	419	1
β-strand	420-421	2	10
α-helix	422	1
β-strand	430-436	7	8
β-strand	441-446	6	8
β-strand	452-455	4	8
α-helix	456	1
α-helix	458-459	2
β-strand	465-470	6	10
α-helix	477-478	2
β-strand	479-481	3	8
α-helix	482-483	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Butyrophilin subfamily 3 member A3	A, B, C, D	protein	221	Homo sapiens	O00478 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>6J0G_1 Butyrophilin subfamily 3 member A3 (chains A, B, C, D)
MGSSHHHHHHSSGLVPRGSHMENLYFQGAGAGAAYHEWKMALFKPADVILDPDTANAILL
VSEDQRSVQRAEEPRDLPDNPERFEWHYCVLGCENFTSGRHYWEVEVGDRKEWHIGVCSK
NVERKKGWVKMTPENGYWTMGLTDGNKYRALTEPRTNLKLPEPPRKVGIFLDYETGEISF
YNATDGSHIYTFPHASFSEPLYPVFRILTLEPTALTICPIP

Ligands and cofactors

ID	Name	Formula	Copies
H6P	(2E)-4-hydroxy-3-methylbut-2-en-1-yl trihydrogen diphosphate	C5 H12 O8 P2	4

Primary citation

A Structural Change in Butyrophilin upon Phosphoantigen Binding Underlies Phosphoantigen-Mediated V gamma 9V delta 2 T Cell Activation. Yang, Y., Li, L., Yuan, L. et al. Immunity (2019) 50:1043. DOI 10.1016/j.immuni.2019.02.016 · PubMed

Other PDB entries of the same protein (UniProt O00478 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6J0L 1.95 Å, Crystal structure of intracellular B30.2 domain of BTN3A3 mutant in complex with sulfate…
6J0K 2.0 Å, Crystal structure of intracellular B30.2 domain of BTN3A3 mutant in complex with HMBPP
4F8T 2.38 Å, Crystal Structure of the Human BTN3A3 Ectodomain
5ZZ3 3.0 Å, Crystal structure of intracellular B30.2 domain of BTN3A3
9II6 3.27 Å, Cryo-EM structure of the intracellular domains of BTN2A1-BTN3A1-BTN3A3
8ZJY 3.7 Å, Cryo-EM structure of pAg-bound BTN2A1-BTN3A1-BTN3A3 in complex with Vgamma9-Vdelta2 TCR…
8ZJZ 3.8 Å, Cryo-EM structure of the full-length pAg-bound BTN2A1-BTN3A1-BTN3A3 complex
8ZYR 4.07 Å, Cryo-EM structure of BTN2A1-BTN3A1-BTN3A3

Browse structure collections

About this viewer

MolViewer shows 6J0G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.