Glycine mutation on single layer beta-sheet of OspAsm1. Determined by X-ray diffraction at 1.2 Å resolution. Released 6 Mar 2019.
Explore 6J48 in 3D Show helices and sheets RCSB PDB PDBe
6J48 contains 2 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 30-34 | 5 | 1 |
| β-strand | 38-42 | 5 | 1 |
| β-strand | 52-58 | 7 | 1 |
| β-strand | 61-67 | 7 | 1 |
| β-strand | 74-79 | 6 | 1 |
| β-strand | 85-90 | 6 | 1 |
| β-strand | 97-102 | 6 | 1 |
| β-strand | 109-115 | 7 | 1 |
| β-strand | 121-126 | 6 | 1 |
| β-strand | 132-138 | 7 | 1 |
| β-strand | 144-148 | 5 | 1 |
| β-strand | 156-161 | 6 | 1 |
| β-strand | 166-171 | 6 | 1 |
| β-strand | 175-182 | 8 | 1 |
| β-strand | 185-192 | 8 | 1 |
| β-strand | 197-203 | 7 | 1 |
| β-strand | 212-217 | 6 | 2 |
| β-strand | 222-227 | 6 | 2 |
| β-strand | 230-237 | 8 | 2 |
| β-strand | 243-247 | 5 | 2 |
| β-strand | 248 | 1 | 3 |
| α-helix | 249 | 1 | |
| β-strand | 255 | 1 | 3 |
| β-strand | 260-261 | 2 | 2 |
| α-helix | 265-271 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Outer surface protein A | O | protein | 251 | Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) | P0CL66 (AlphaFold model) |
>6J48_1 Outer surface protein A (chains O) GSHMKNSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKAD ASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKSSGEEKFNEKGEVSEKIITRADG TRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGAVSVELN DTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEI TKLDEIKNALK
Grafting a short chameleon sequence from alpha B crystallin into a beta-sheet scaffold protein. Hori, Y., Fujiwara, H., Fujiwara, W. et al. Proteins (2019) 87:416-424. DOI 10.1002/prot.25663 · PubMed
Other PDB entries of the same protein (UniProt P0CL66 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6J48 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.