Crystal Structure of YAP1 and Dendrin complex. Determined by X-ray diffraction at 3.1 Å resolution. Released 25 Sept 2019.
Explore 6JK0 in 3D Show helices and sheets RCSB PDB PDBe
6JK0 contains 5 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 148-151 | 4 | 1 |
| α-helix | 157-159 | 3 | |
| β-strand | 162-166 | 5 | 2 |
| β-strand | 172-176 | 5 | 2 |
| β-strand | 181-183 | 3 | 2 |
| β-strand | 191-194 | 4 | 1 |
| α-helix | 216-218 | 3 | |
| β-strand | 221-225 | 5 | 3 |
| β-strand | 231-235 | 5 | 3 |
| β-strand | 240-242 | 3 | 3 |
| α-helix | 246-248 | 3 | |
| α-helix | 249-253 | 5 | |
| α-helix | 255-258 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transcriptional coactivator YAP1,Dendrin | A | protein | 132 | Mus musculus | P46938 (AlphaFold model), Q80TS7 (AlphaFold model) |
>6JK0_1 Transcriptional coactivator YAP1,Dendrin (chains A) MHHHHHHSSGLEVLFQGPGSVPLPAGWEMAKTSSGQRYFLNHNDQTTTWQDPRKAMLSQL NVPAPASPAVPQTLMNSASGPLPDGWEQAMTQDGEVYYINHKNKTTSWLDPRDRPPPYVA PPSYEGPHRTLG
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 2 |
Decoding WW domain tandem-mediated target recognitions in tissue growth and cell polarity. Lin, Z., Yang, Z., Xie, R. et al. Elife (2019) 8. DOI 10.7554/eLife.49439 · PubMed
Other PDB entries of the same protein (UniProt P46938 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6JK0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.