6JK1: YAP1 and Dendrin complex 2

Crystal Structure of YAP1 and Dendrin complex 2. Determined by X-ray diffraction at 2.0 Å resolution. Released 25 Sept 2019.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Mus musculus
Chains: 2
Atoms: 1,631
Mol. weight: 25.54 kDa
Released: 25 Sept 2019

Explore 6JK1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6JK1 contains 8 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	138-141	4
α-helix	143-144	2
α-helix	146	1
β-strand	153-154	2	1
α-helix	157-159	3
β-strand	162-166	5	2
β-strand	172-176	5	2
β-strand	181-183	3	2
α-helix	215-218	4
β-strand	221-225	5	1
β-strand	231-235	5	1
β-strand	240-242	3	1

Chain B: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	138-141	4
β-strand	152-154	3	3
α-helix	157-159	3
β-strand	162-166	5	4
β-strand	172-176	5	4
β-strand	181-183	3	4
α-helix	216-218	3
β-strand	221-225	5	3
β-strand	231-235	5	3
β-strand	240-242	3	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dendrin,Transcriptional coactivator YAP1	A, B	protein	116	Mus musculus	P46938 (AlphaFold model), Q80TS7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6JK1_1 Dendrin,Transcriptional coactivator YAP1 (chains A, B)
GPGSDRPPPYVAPPSYEGPHRTLGVPLPAGWEMAKTSSGQRYFLNHNDQTTTWQDPRKAM
LSQLNVPAPASPAVPQTLMNSASGPLPDGWEQAMTQDGEVYYINHKNKTTSWLDPR

Primary citation

Decoding WW domain tandem-mediated target recognitions in tissue growth and cell polarity. Lin, Z., Yang, Z., Xie, R. et al. Elife (2019) 8. DOI 10.7554/eLife.49439 · PubMed

Other PDB entries of the same protein (UniProt P46938 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3JUA 3.0 Å, Structural basis of YAP recognition by TEAD4 in the Hippo pathway
6JK0 3.1 Å, Crystal Structure of YAP1 and Dendrin complex

Browse structure collections

About this viewer

MolViewer shows 6JK1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.