6JNP: Exoenzyme T
Structure of ExoT-SpcS Complex from Pseudomonas aeruginosa in 2.2 Angstrom. Determined by X-ray diffraction at 2.26 Å resolution. Released 3 Apr 2019.
- Method
- X-ray diffraction
- Resolution
- 2.26 Å
- Organism
- Pseudomonas aeruginosa
- Chains
- 6
- Atoms
- 4,741
- Mol. weight
- 65.3 kDa
- Released
- 3 Apr 2019
Explore 6JNP in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6JNP contains 28 α-helices and 24 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 29-32 | 4 | 1 |
| α-helix | 33-35 | 3 | |
| α-helix | 36-41 | 6 | |
| α-helix | 53-57 | 5 | |
| β-strand | 61 | 1 | 2 |
| α-helix | 66-78 | 13 | |
Chain B: 5 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-22 | 4 | |
| β-strand | 28-32 | 5 | 2 |
| β-strand | 35-41 | 7 | 2 |
| β-strand | 46-53 | 8 | 2 |
| α-helix | 63-65 | 3 | |
| β-strand | 75-78 | 4 | 2 |
| β-strand | 85-92 | 8 | 2 |
| α-helix | 93-95 | 3 | |
| α-helix | 98-113 | 16 | |
Chain C: 4 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-15 | 13 | |
| β-strand | 28-32 | 5 | 1 |
| β-strand | 35-41 | 7 | 1 |
| β-strand | 46-52 | 7 | 1 |
| α-helix | 61-64 | 4 | |
| α-helix | 73-74 | 2 | |
| β-strand | 75-78 | 4 | 1 |
| β-strand | 85-92 | 8 | 1 |
| α-helix | 98-114 | 17 | |
Chain D: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 31-32 | 2 | 3 |
| α-helix | 33-35 | 3 | |
| α-helix | 36-41 | 6 | |
| α-helix | 53-57 | 5 | |
| β-strand | 60-61 | 2 | 4 |
| α-helix | 66-78 | 13 | |
Chain E: 6 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-21 | 3 | |
| β-strand | 28-32 | 5 | 4 |
| β-strand | 35-41 | 7 | 4 |
| β-strand | 46-53 | 8 | 4 |
| α-helix | 63-65 | 3 | |
| α-helix | 73-74 | 2 | |
| β-strand | 75-78 | 4 | 4 |
| β-strand | 85-92 | 8 | 4 |
| α-helix | 93-95 | 3 | |
| α-helix | 98-114 | 17 | |
Chain F: 5 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-21 | 3 | |
| β-strand | 28-32 | 5 | 3 |
| β-strand | 35-41 | 7 | 3 |
| β-strand | 46-53 | 8 | 3 |
| α-helix | 73-74 | 2 | |
| β-strand | 75-78 | 4 | 3 |
| β-strand | 85-92 | 8 | 3 |
| α-helix | 93-95 | 3 | |
| α-helix | 98-114 | 17 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Exoenzyme T | A, D | protein | 57 | Pseudomonas aeruginosa | Q9I788 (AlphaFold model) |
| CesT family type III secretion system chaperone | B, C, E, F | protein | 116 | Pseudomonas aeruginosa | G3XD93 (AlphaFold model) |
Sequence of entity 1 (A, D), FASTA
>6JNP_1 Exoenzyme T (chains A, D)
RLGEVEARQVATPREAQQLAQRQEAPKGEGLLSRLGAALARPFVAIIEWLGKLLGSR
Sequence of entity 2 (B, C, E, F), FASTA
>6JNP_2 CesT family type III secretion system chaperone (chains B, C, E, F)
MNPLYRAAIHQLFLALDLPTPNDEESVLSLQVGPHLCHLAEHPTDHLLMFTRLEGQGDAT
ANEQNLFSQDPCKPILGRDPESGERLLWNRQPLQLLDRAQIHHQLEQLVAAAEELR
Primary citation
Structure of ExoT-SpcS Complex from Pseudomonas aeruginosa. Datta, S., Mondal, A. To be published.
Other PDB entries of the same protein (UniProt Q9I788 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4JMF 2.1 Å, Crystal structure of ExoT (residues 28 -77)- SpcS complex from Pseudomonas aeruginosa at…
- 6GNN 3.79 Å, Exoenzyme T from Pseudomonas aeruginosa in complex with human 14-3-3 protein beta,…
Browse structure collections
About this viewer
MolViewer shows 6JNP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.