6K06: Importin-alpha and phosphomimetic GM130

Crystal structure of Importin-alpha and phosphomimetic GM130. Determined by X-ray diffraction at 1.75 Å resolution. Released 2 Oct 2019.

Method: X-ray diffraction
Resolution: 1.75 Å
Organisms: Homo sapiens, Mus musculus
Chains: 2
Atoms: 3,871
Mol. weight: 52.7 kDa
Released: 2 Oct 2019

Explore 6K06 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6K06 contains 32 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	17-24	8

Chain C: 31 helices, 0 β-strands

Element	Residues	Length
α-helix	78-85	8
α-helix	90-105	16
α-helix	112-117	6
α-helix	121-128	8
α-helix	134-148	15
α-helix	152-160	9
α-helix	163-170	8
α-helix	176-190	15
α-helix	194-202	9
α-helix	206-212	7
α-helix	218-220	3
α-helix	223-236	14
α-helix	243-245	3
α-helix	246-259	14
α-helix	265-278	14
α-helix	283-290	8
α-helix	295-302	8
α-helix	307-320	14
α-helix	325-333	9
α-helix	336-339	4
α-helix	340-343	4
α-helix	349-362	14
α-helix	367-375	9
α-helix	378-387	10
α-helix	391-407	17
α-helix	410-418	9
α-helix	422-428	7
α-helix	434-454	21
α-helix	457-466	10
α-helix	469-476	8
α-helix	482-495	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peptide from Golgin subfamily A member 2	A	protein	53	Homo sapiens	Q08379 (AlphaFold model)
Importin subunit alpha-1	C	protein	433	Mus musculus	P52293 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6K06_1 Peptide from Golgin subfamily A member 2 (chains A)
GPLGSMSEETRQSKLAAAKKKLREYQQRNDPGVPTGAKKKKKIKNGSNPETTT

Sequence of entity 2 (C), FASTA

>6K06_2 Importin subunit alpha-1 (chains C)
GSHMNQGTVNWSVEDIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFV
SFLGKTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWA
LGNIAGDGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPP
LDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGAT
ELPIVTPALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAG
RQDQIQQVVNHGLVPFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPL
MNLLSAKDTKIIQVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVY
KASLNLIEKYFSV

Primary citation

Ran pathway-independent regulation of mitotic Golgi disassembly by Importin-alpha. Chang, C.-C., Chen, C.-J., Grauffel, C. et al. Nat Commun (2019) 10:4307-4307. DOI 10.1038/s41467-019-12207-4 · PubMed

Other PDB entries of the same protein (UniProt Q08379 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4REY 1.96 Å, Crystal Structure of the GRASP65-GM130 C-terminal peptide complex
6IWA 2.4 Å, Crystal structure of Importin-alpha and phosphoserine GM130
6IW8 2.8 Å, Crystal structure of Importin-alpha and wild-type GM130

Browse structure collections

About this viewer

MolViewer shows 6K06 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.