6K11: MvcA from Legionella pneumophila

Crystal structure of MvcA from Legionella pneumophila. Determined by X-ray diffraction at 1.94 Å resolution. Released 18 Dec 2019.

Method: X-ray diffraction
Resolution: 1.94 Å
Organism: Legionella pneumophila subsp. pneumophila str. Philadelphia 1
Chains: 2
Atoms: 6,613
Mol. weight: 87.83 kDa
Released: 18 Dec 2019

Explore 6K11 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6K11 contains 50 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	16-31	16
α-helix	32-36	5
α-helix	40-51	12
α-helix	52-54	3
α-helix	61-76	16
α-helix	83-95	13
α-helix	97-105	9
α-helix	107-108	2
β-strand	109-110	2	1
α-helix	111-112	2
α-helix	116-123	8
β-strand	132-141	10	1
β-strand	146-149	4	2
α-helix	152-154	3
α-helix	161	1
β-strand	164-167	4	2
β-strand	172-175	4	2
β-strand	181-183	3	2
α-helix	188-197	10
β-strand	204-205	2	2
α-helix	209-213	5
α-helix	218-232	15
α-helix	234-236	3
β-strand	240-250	11	1
α-helix	251-254	4
α-helix	257-259	3
β-strand	262-264	3	1
β-strand	267	1	3
β-strand	271	1	3
α-helix	273-278	6
α-helix	281-286	6
α-helix	290-300	11
α-helix	306-317	12
α-helix	319	1
α-helix	329-331	3
β-strand	337-345	9	1
α-helix	348-363	16
α-helix	370-393	24

Chain B: 24 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	16-31	16
α-helix	32-36	5
α-helix	40-51	12
α-helix	52-54	3
α-helix	61-75	15
α-helix	83-105	23
α-helix	107-108	2
β-strand	109-110	2	4
α-helix	111-112	2
α-helix	116-123	8
β-strand	132-141	10	4
β-strand	146-149	4	5
α-helix	152-154	3
α-helix	161	1
β-strand	164-167	4	5
β-strand	172-175	4	5
β-strand	181-183	3	5
α-helix	188-197	10
β-strand	203-205	3	5
α-helix	218-232	15
α-helix	234-236	3
β-strand	240-250	11	4
α-helix	251-253	3
α-helix	257-259	3
β-strand	262-264	3	4
β-strand	267	1	6
β-strand	271	1	6
α-helix	273-279	7
α-helix	281-286	6
α-helix	290-302	13
α-helix	306-317	12
α-helix	319	1
α-helix	329-331	3
β-strand	337-345	9	4
α-helix	348-363	16
α-helix	370-393	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lpg2148(MvcA)	A, B	protein	383	Legionella pneumophila subsp. pneumophila str. Philadelphia 1	Q5ZTL3 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6K11_1 Lpg2148(MvcA) (chains A, B)
LESPGFMVHKKLKSMSQSYGVMMTGVPAEVLGQMQAERSIPSINKTGNLKQQIAKEVSKV
CHMMTEPTQSCGQASNDVCELLLGKIEAEKFHFTKYEALSADGDNLKNVLENTAPSSTNL
LIRFEIDREDPPIVLVKTKNENFNPETAVKNKIYLLENKLYFIDKMGNLFNLGPGKKKCT
QLFNAIGDSAEYSLCDPFVLEEPEKPEDFAISEIVDIFNEQKERFDFWIGSHSFTIYIPQ
TLGESPRQFYPYQAYFGSHTLQDWFVSDKDEYLSRIGIDKYIEKLAVLGKTTNTKERSDI
YAEFFSKRGREAFFCAHLNEKRQPLRVKFKITEINPELALKNLQETQEFIDTHPGENPSD
KVENYRNRAKLAMTEHLESLLDI

Primary citation

Legionella pneumophila regulates the activity of UBE2N by deamidase-mediated deubiquitination. Gan, N., Guan, H., Huang, Y. et al. EMBO J (2020) 39:e102806-e102806. DOI 10.15252/embj.2019102806 · PubMed

Other PDB entries of the same protein (UniProt Q5ZTL3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5SUJ 2.36 Å, Crystal structure of uncharacterized protein LPG2148 from Legionella pneumophila
6JKY 2.45 Å, Crystal structure of MvcA-UBE2N-Ub complex from Legionella pneumophila
6LP2 2.48 Å, Structure of Lpg2148/UBE2N-Ub complex
5YM9 2.5 Å, Crystal Structure of the Deamidase from Legionella pneumophila
6LW4 2.7 Å, Structure of Lpg2148/Lpg2149 complex
7BXF 2.7 Å, MvcA-Lpg2149 complex

Browse structure collections

About this viewer

MolViewer shows 6K11 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.