6K8Q: PDB entry 6K8Q

Solution structure of the intermembrane space domain of the mitochondrial import protein Tim21 from S. cerevisiae. Determined by solution NMR. Released 11 Sept 2019.

Method: Solution NMR
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Chains: 1
Atoms: 952
Mol. weight: 13.57 kDa
Released: 11 Sept 2019

Explore 6K8Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6K8Q contains 3 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	2-16	15
α-helix	18-23	6
β-strand	28	1	1
β-strand	33	1	1
β-strand	37-39	3	2
α-helix	52-55	4
β-strand	57-60	4	2
β-strand	66-75	10	2
β-strand	80-89	10	2
β-strand	96-104	9	2
β-strand	111-112	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitochondrial import inner membrane translocase subunit TIM21	A	protein	115	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P53220 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6K8Q_1 Mitochondrial import inner membrane translocase subunit TIM21 (chains A)
GSDTQLFNRAVSMVEKNKDIRSLLQCDDGITGKERLKAYGELITNDKWTRNRPIVSTKKL
DKEGRTHHYMRFHVESKKKIALVHLEAKESKQNYQPDFINMYVDVPGEKRYYLIK

Primary citation

Crystal contact-free conformation of an intrinsically flexible loop in protein crystal: Tim21 as the case study. Bala, S., Shinya, S., Srivastava, A. et al. Biochim Biophys Acta Gen Subj (2020) 1864:129418-129418. DOI 10.1016/j.bbagen.2019.129418 · PubMed

Other PDB entries of the same protein (UniProt P53220 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6K7E 1.53 Å, Crystal structure of MBPapo-Tim21 fusion protein with a 17-residue helical linker
2CIU 1.6 Å, Structure of the IMS domain of the mitochondrial import protein Tim21 from S. cerevisiae
6K7F 1.8 Å, Crystal structure of MBPholo-Tim21 fusion protein with a 17-residue helical linker
6K7D 2.0 Å, Crystal structure of MBPapo-Tim21 fusion protein with a 16-residue helical linker
2MF7 Solution structure of the ims domain of the mitochondrial import protein TIM21 from S.…

Browse structure collections

About this viewer

MolViewer shows 6K8Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.