Crystal structure of human NRMT2 in complex with alpha-N-monomethylated human CENP-A peptide. Determined by X-ray diffraction at 1.84 Å resolution. Released 8 Jul 2020.
Explore 6KDS in 3D Show helices and sheets RCSB PDB PDBe
6KDS contains 15 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 65-77 | 13 | |
| α-helix | 83-87 | 5 | |
| α-helix | 91-93 | 3 | |
| α-helix | 94-108 | 15 | |
| β-strand | 109 | 1 | 1 |
| β-strand | 115 | 1 | 1 |
| β-strand | 119-123 | 5 | 2 |
| α-helix | 129-130 | 2 | |
| α-helix | 131-135 | 5 | |
| β-strand | 141-146 | 6 | 2 |
| α-helix | 149-158 | 10 | |
| α-helix | 160-165 | 6 | |
| β-strand | 166-171 | 6 | 2 |
| α-helix | 174-176 | 3 | |
| α-helix | 179-180 | 2 | |
| β-strand | 184-190 | 7 | 2 |
| α-helix | 193-195 | 3 | |
| α-helix | 198-210 | 13 | |
| β-strand | 212-223 | 12 | 2 |
| β-strand | 225 | 1 | 3 |
| β-strand | 230-232 | 3 | 4 |
| β-strand | 237-239 | 3 | 4 |
| β-strand | 241 | 1 | 3 |
| α-helix | 242-251 | 10 | |
| β-strand | 256-261 | 6 | 2 |
| α-helix | 262-263 | 2 | |
| β-strand | 269 | 1 | 5 |
| α-helix | 270-271 | 2 | |
| β-strand | 272-277 | 6 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4 | 1 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Alpha N-terminal protein methyltransferase 1B | A | protein | 244 | Homo sapiens | Q5VVY1 (AlphaFold model) |
| CENP-A peptide | E | protein | 6 | Homo sapiens | P49450 (AlphaFold model) |
>6KDS_1 Alpha N-terminal protein methyltransferase 1B (chains A) MGSSHHHHHHSSGLVPRGSHMVINGEMQFYARAKLFYQEVPATEEGMMGNFIELSSPDIQ ASQKFLRKFVGGPGRAGTDCALDCGSGIGRVSKHVLLPVFNSVELVDMMESFLLEAQNYL QVKGDKVESYHCYSLQEFTPPFRRYDVIWIQWVSGHLTDKDLLAFLSRCRDGLKENGIII LKDNVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPVWMFALHS DRHS
>6KDS_2 CENP-A peptide (chains E) GPRRRS
| ID | Name | Formula | Copies |
|---|---|---|---|
| SAH | S-adenosyl-L-homocysteine | C14 H20 N6 O5 S | 1 |
Substrate engagement regulates state-specific alpha-N methylation of CENP-A by NRMT2. Wu, R., Yue, Y., Zheng, X. et al. To be published.
Other PDB entries of the same protein (UniProt Q5VVY1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6KDS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.